SecReT6
Protein ID: 300723447
SecReT6 ID398
T6SS typei3
Gene symbol-
Locus tagXNC1_2531
StrainXenorhabdus nematophila ATCC 19061
Repliconchromosome [GenBank: NC_014228] [Browse all T6SS(s) in this replicon]
Location [Strand]2485064..2486098 [+]
Producthypothetical protein
NoteTssG
UniProt IDD3VHE4
KEGG IDxne:XNC1_2531
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.00E-100, Aligned region: 25..329
Protein Sequence: 344 a.a.     [Download]
>gi|300723447|ref|YP_003712752.1| unnamed protein product [Xenorhabdus nematophila ATCC 19061]
MNQTNPISLHRLCRLPEDFWPKFMQAPWQFDLFQALRRIDAQSGAYYMLGSAPLPRYELLRLGQKASMIF
APSTISTVKQRENSTLYDILIYSFGLFGPNGPMPLHITEYTYARQYNYQDPTLSSFINLFHHRLILLFYR
AWANAQPTVSLDRQDNQRFCRYLACLVGMGLPAQQKPDTINDHARYSLSGHLSRQRHSAEGLEKILLSYF
GIPVKIQQNIPQWLNVEARDQAQLTAGRSRPRLGHSAFLGIALYDVQHKFRIELGPLSRAEYDMFLPGEP
KSQQLRDWIYQYLGIEYAWDVRLVLHQSEITGINLSESIKLGLNSWLGKIEQPTHRGDLRYNNQ
 
Nucleotide Sequence: 1035 bp     [Download]
>gi|300721089|ref|NC_014228.1|:2485064-2486098 Xenorhabdus nematophila ATCC 19061 chromosome, complete genome
ATGAATCAGACAAACCCGATTTCCCTTCATCGCCTGTGTCGTTTGCCAGAAGATTTTTGGCCGAAATTTA
TGCAAGCACCGTGGCAATTTGATTTATTTCAGGCATTACGCCGTATAGATGCGCAATCCGGTGCCTACTA
CATGCTCGGTTCTGCTCCATTACCAAGATATGAGCTTTTGCGGTTAGGGCAAAAAGCATCCATGATTTTT
GCACCCTCAACGATTTCTACAGTTAAACAGAGAGAAAATTCAACACTGTATGACATTCTTATTTACAGTT
TTGGTTTGTTCGGCCCGAATGGACCCATGCCATTACATATCACCGAGTATACTTATGCCCGACAATATAA
TTATCAAGATCCTACCTTAAGCTCATTTATTAATTTATTTCATCACAGACTGATATTGCTATTCTACAGA
GCCTGGGCTAATGCCCAACCGACCGTTTCACTCGATCGACAGGATAATCAACGTTTTTGCCGTTATCTTG
CTTGTCTGGTGGGAATGGGATTACCCGCCCAGCAGAAGCCCGACACCATAAATGACCATGCCCGTTATTC
ACTCTCTGGTCATTTATCCCGCCAAAGACACAGTGCGGAAGGGCTGGAAAAAATCCTGCTCAGTTATTTC
GGTATTCCCGTGAAAATTCAACAAAATATCCCTCAATGGTTAAACGTTGAAGCACGGGATCAGGCCCAAT
TAACAGCGGGACGAAGCCGGCCCCGTTTAGGTCACTCCGCCTTTTTGGGTATTGCACTATACGATGTTCA
ACACAAATTTCGCATTGAATTAGGCCCGTTAAGCAGGGCTGAATATGACATGTTTTTACCCGGAGAACCT
AAATCACAACAATTGCGTGACTGGATTTATCAATATCTGGGAATCGAATACGCCTGGGATGTTCGGCTGG
TACTTCATCAATCAGAGATAACAGGCATTAATCTATCAGAATCCATAAAATTAGGTCTGAACAGCTGGCT
TGGCAAAATTGAACAACCCACCCACCGCGGGGACTTACGTTATAACAACCAATAA