SecReT6
Protein ID: 300723448
SecReT6 ID398
T6SS typei3
Gene symbol-
Locus tagXNC1_2532
StrainXenorhabdus nematophila ATCC 19061
Repliconchromosome [GenBank: NC_014228] [Browse all T6SS(s) in this replicon]
Location [Strand]2486177..2488816 [+]
ProductClpA/B-type chaperone
NoteTssH
UniProt IDD3VHE5
KEGG IDxne:XNC1_2532
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.20E-40, Aligned region: 231..248
AAA_2 [PF07724], Evalue: 1.20E-40, Aligned region: 291..309
AAA_2 [PF07724], Evalue: 1.20E-40, Aligned region: 610..776
AAA [PF00004], Evalue: 6.00E-20, Aligned region: 123..149
AAA [PF00004], Evalue: 6.00E-20, Aligned region: 231..333
AAA [PF00004], Evalue: 6.00E-20, Aligned region: 380..397
AAA [PF00004], Evalue: 6.00E-20, Aligned region: 616..700
ClpB_D2-small [PF10431], Evalue: 2.40E-16, Aligned region: 212..225
ClpB_D2-small [PF10431], Evalue: 2.40E-16, Aligned region: 783..858
AAA_5 [PF07728], Evalue: 5.30E-12, Aligned region: 231..250
AAA_5 [PF07728], Evalue: 5.30E-12, Aligned region: 364..396
AAA_5 [PF07728], Evalue: 5.30E-12, Aligned region: 615..734
AAA_22 [PF13401], Evalue: 4.20E-09, Aligned region: 231..316
AAA_22 [PF13401], Evalue: 4.20E-09, Aligned region: 614..639
AAA_22 [PF13401], Evalue: 4.20E-09, Aligned region: 677..700
AAA_16 [PF13191], Evalue: 1.90E-07, Aligned region: 35..76
AAA_16 [PF13191], Evalue: 1.90E-07, Aligned region: 124..183
AAA_16 [PF13191], Evalue: 1.90E-07, Aligned region: 208..254
AAA_16 [PF13191], Evalue: 1.90E-07, Aligned region: 502..540
AAA_16 [PF13191], Evalue: 1.90E-07, Aligned region: 612..660
Sigma54_activat [PF00158], Evalue: 1.90E-07, Aligned region: 225..245
Sigma54_activat [PF00158], Evalue: 1.90E-07, Aligned region: 302..311
Sigma54_activat [PF00158], Evalue: 1.90E-07, Aligned region: 615..731
AAA_14 [PF13173], Evalue: 6.40E-06, Aligned region: 54..70
AAA_14 [PF13173], Evalue: 6.40E-06, Aligned region: 231..311
AAA_14 [PF13173], Evalue: 6.40E-06, Aligned region: 359..397
AAA_14 [PF13173], Evalue: 6.40E-06, Aligned region: 614..725
IstB_IS21 [PF01695], Evalue: 1.20E-05, Aligned region: 215..254
IstB_IS21 [PF01695], Evalue: 1.20E-05, Aligned region: 615..635
AAA_19 [PF13245], Evalue: 2.30E-05, Aligned region: 230..255
AAA_19 [PF13245], Evalue: 2.30E-05, Aligned region: 613..638
AAA_17 [PF13207], Evalue: 5.40E-05, Aligned region: 231..251
AAA_17 [PF13207], Evalue: 5.40E-05, Aligned region: 472..510
AAA_17 [PF13207], Evalue: 5.40E-05, Aligned region: 615..651
Zeta_toxin [PF06414], Evalue: 0.00015, Aligned region: 230..248
Zeta_toxin [PF06414], Evalue: 0.00015, Aligned region: 608..665
AAA_18 [PF13238], Evalue: 0.00016, Aligned region: 231..250
AAA_18 [PF13238], Evalue: 0.00016, Aligned region: 531..579
AAA_18 [PF13238], Evalue: 0.00016, Aligned region: 617..643
Arch_ATPase [PF01637], Evalue: 0.00021, Aligned region: 210..245
Arch_ATPase [PF01637], Evalue: 0.00021, Aligned region: 284..314
Arch_ATPase [PF01637], Evalue: 0.00021, Aligned region: 359..402
Arch_ATPase [PF01637], Evalue: 0.00021, Aligned region: 614..654
NACHT [PF05729], Evalue: 0.00038, Aligned region: 231..258
NACHT [PF05729], Evalue: 0.00038, Aligned region: 616..643
AAA_29 [PF13555], Evalue: 0.00054, Aligned region: 223..248
AAA_29 [PF13555], Evalue: 0.00054, Aligned region: 613..639
AAA_25 [PF13481], Evalue: 0.0009, Aligned region: 215..253
AAA_25 [PF13481], Evalue: 0.0009, Aligned region: 286..328
AAA_25 [PF13481], Evalue: 0.0009, Aligned region: 612..642
AAA_25 [PF13481], Evalue: 0.0009, Aligned region: 791..824
SRP54 [PF00448], Evalue: 0.0015, Aligned region: 230..254
SRP54 [PF00448], Evalue: 0.0015, Aligned region: 614..648
FtsK_SpoIIIE [PF01580], Evalue: 0.0017, Aligned region: 217..274
FtsK_SpoIIIE [PF01580], Evalue: 0.0017, Aligned region: 467..524
FtsK_SpoIIIE [PF01580], Evalue: 0.0017, Aligned region: 614..640
RNA_helicase [PF00910], Evalue: 0.0022, Aligned region: 232..252
RNA_helicase [PF00910], Evalue: 0.0022, Aligned region: 616..637
RNA_helicase [PF00910], Evalue: 0.0022, Aligned region: 713..734
DUF815 [PF05673], Evalue: 0.0023, Aligned region: 222..306
DUF815 [PF05673], Evalue: 0.0023, Aligned region: 613..656
Clp_N [PF02861], Evalue: 0.003, Aligned region: 28..75
Clp_N [PF02861], Evalue: 0.003, Aligned region: 111..123
T2SE [PF00437], Evalue: 0.0035, Aligned region: 199..252
T2SE [PF00437], Evalue: 0.0035, Aligned region: 612..692
DUF258 [PF03193], Evalue: 0.0061, Aligned region: 220..249
DUF258 [PF03193], Evalue: 0.0061, Aligned region: 614..632
Hpr_kinase_C [PF07475], Evalue: 0.0069, Aligned region: 231..243
Hpr_kinase_C [PF07475], Evalue: 0.0069, Aligned region: 500..536
Hpr_kinase_C [PF07475], Evalue: 0.0069, Aligned region: 613..634
NTPase_1 [PF03266], Evalue: 0.0086, Aligned region: 231..255
NTPase_1 [PF03266], Evalue: 0.0086, Aligned region: 282..308
NTPase_1 [PF03266], Evalue: 0.0086, Aligned region: 615..638
Protein Sequence: 879 a.a.     [Download]
>gi|300723448|ref|YP_003712753.1| unnamed protein product [Xenorhabdus nematophila ATCC 19061]
MSEINRSVLFSKLNRVLFNSLESATTFCKLRGNPYVELVHWLHQLTQQQNSDLQQIIRYFSFDESALTKD
IVAALDRLPRGASAISDLSEHIDNSVERAWTYCSLTFGVDKIRSAHLLIGILKTFNLRNVLKAISTQFDR
INADTLLDNVNEICSHSDEAQERTPLSENSTQPTTQQTATHSALQLSALQRYGQELTARARNGEIDPVSG
RDEEIRQIVDILMRRRQNNPLLTGEAGVGKTAVIEGLALKIVAEEVPPPLRHVQLWLLDIGMLQAGAGVK
GEFESRLRNVIDEVQSSPIPIILFIDEIHTLIGAGGQQGTGDAANLLKPALARGLLRTLGATTWSEYKKY
IEKDPALTRRFQVVQVHEPDETKALLMLRSLVNILEKHHHVLLLDEAVDAAVRLSHRYIPARQLPDKAIA
LLDTACARVAVSQHGEPAQLENCRHQINALKIELEIIKRESRLGIGDTQRSDIILDQLAILEEQKTQVQE
RWEQELALIDKIISLRIQLNEEQPQDTKTRHDELAELQQQLKILQGEEPLIFAAVDSNVVSSVVSDWTGI
PLNRMVKDEIDSVLQLADTLNQRVIGQYHGLELIAKRVRTSRAKLDDPNKPVGVFMLCGPSGVGKTETAL
ALAETLYSGEQNLITINMSEFQEAHTVSTLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLLDEIEKAHPDV
HEIFFQVFDKGWMEDGEGRHIDFKNTIIILTSNVGADLVSSLCTQQETMPEPEKLSTALRRPLLNVFPAA
LLGRLLVIPYYPLSHKVMTKIVYLQLERIQKRLSENHGITATFDDAMVEHIVNRCTEIESGGRMVDAILT
NTLLPQISQQLLFASTRDKQYRQLNVFLDQGEFQFEFMD
 
Nucleotide Sequence: 2640 bp     [Download]
>gi|300721089|ref|NC_014228.1|:2486177-2488816 Xenorhabdus nematophila ATCC 19061 chromosome, complete genome
ATGTCAGAAATCAATCGTTCCGTACTTTTTAGTAAACTCAACCGGGTTTTGTTCAATTCTTTGGAAAGCG
CCACCACCTTTTGTAAATTACGGGGTAATCCTTATGTTGAATTAGTTCACTGGCTGCATCAGCTTACGCA
GCAGCAAAACAGCGATCTACAGCAAATTATCCGTTATTTTTCATTCGATGAATCTGCTCTGACCAAAGAC
ATTGTTGCCGCTCTGGATCGCTTGCCCCGTGGTGCCAGCGCTATTTCTGATCTTTCAGAGCATATTGATA
ATTCGGTTGAACGTGCCTGGACATACTGTTCACTGACATTTGGTGTTGATAAAATCCGCAGTGCACATTT
GTTAATCGGGATATTAAAAACGTTTAATTTACGCAATGTACTGAAAGCCATTTCAACCCAATTTGACCGG
ATTAATGCAGATACCTTACTCGACAACGTCAATGAAATTTGCAGCCACAGCGATGAAGCCCAAGAACGTA
CCCCGCTCTCAGAAAACAGTACCCAGCCGACAACCCAACAGACAGCGACACATTCCGCCCTGCAACTATC
CGCATTGCAACGCTATGGACAAGAACTGACTGCCCGTGCACGCAACGGTGAAATTGATCCGGTATCAGGG
CGTGATGAAGAAATTCGTCAGATTGTTGACATCCTGATGCGTCGTCGTCAAAACAACCCCCTGCTAACCG
GTGAGGCTGGCGTCGGCAAAACCGCCGTGATTGAAGGACTGGCATTAAAAATTGTTGCAGAAGAGGTTCC
TCCGCCATTGCGTCATGTTCAGCTCTGGTTATTGGATATCGGGATGCTACAAGCAGGCGCCGGCGTTAAA
GGCGAATTTGAATCCCGGTTACGCAACGTGATTGATGAAGTACAATCCAGCCCGATCCCAATCATTCTGT
TCATTGATGAAATTCACACCTTGATTGGTGCCGGCGGACAACAAGGAACCGGGGATGCGGCCAATTTGTT
AAAACCGGCATTAGCACGTGGCCTGTTGCGTACGCTTGGTGCCACTACCTGGTCTGAATATAAAAAATAT
ATCGAAAAAGATCCCGCCCTCACCCGCCGCTTTCAGGTTGTCCAGGTGCATGAACCCGATGAAACCAAAG
CATTGCTGATGCTACGCAGTCTGGTCAATATCCTGGAGAAGCACCACCATGTGCTCTTGCTGGATGAAGC
TGTTGACGCTGCCGTGCGTTTATCACATCGCTATATTCCGGCCCGCCAACTGCCGGATAAAGCCATAGCA
CTGCTTGATACCGCTTGTGCCAGAGTTGCAGTCAGCCAGCACGGAGAACCCGCGCAACTGGAAAATTGTC
GTCATCAGATAAATGCATTGAAAATTGAGCTGGAAATCATAAAACGAGAATCCAGGTTAGGCATCGGTGA
TACGCAACGTTCAGACATTATTCTGGATCAACTCGCCATTCTGGAAGAACAGAAAACCCAAGTGCAGGAA
CGCTGGGAACAGGAACTTGCTTTAATCGACAAAATTATTTCCTTACGAATTCAATTAAATGAAGAACAGC
CTCAGGATACAAAAACCCGGCATGACGAGCTGGCAGAATTACAACAACAATTAAAAATATTACAAGGAGA
AGAACCCCTTATTTTTGCTGCCGTAGACAGCAATGTGGTTTCTTCTGTGGTGTCAGACTGGACCGGCATT
CCCTTGAACCGCATGGTAAAAGACGAAATCGATTCAGTATTGCAATTAGCCGATACACTCAACCAGCGTG
TTATCGGCCAGTATCACGGATTAGAATTAATCGCAAAACGGGTACGAACCTCACGGGCAAAACTGGATGA
TCCGAACAAACCAGTTGGTGTTTTCATGCTATGCGGCCCATCTGGGGTCGGTAAAACGGAAACCGCACTT
GCCCTTGCAGAAACGTTATATAGCGGAGAACAAAACCTGATCACCATCAATATGAGTGAATTTCAGGAAG
CACATACCGTATCTACGTTAAAAGGTGCTCCTCCCGGCTATGTCGGTTATGGTGAAGGTGGTGTATTGAC
CGAAGCAGTCCGACGCCGGCCTTACAGTGTCGTTCTGTTGGATGAAATAGAAAAAGCGCACCCTGATGTC
CATGAAATTTTCTTTCAGGTCTTCGATAAAGGCTGGATGGAAGATGGCGAAGGTCGCCACATTGATTTTA
AAAATACGATTATTATTCTGACTTCCAATGTCGGGGCTGATCTGGTCAGTTCACTCTGCACTCAGCAAGA
AACCATGCCAGAACCAGAAAAACTCAGCACGGCATTGCGCAGGCCATTATTGAACGTCTTTCCTGCGGCT
TTATTAGGGCGTTTACTGGTTATTCCTTACTATCCATTAAGTCACAAAGTGATGACAAAAATTGTCTACC
TGCAATTAGAAAGGATTCAGAAACGTTTGTCAGAAAATCATGGCATCACAGCAACATTTGATGATGCCAT
GGTAGAACACATCGTCAACCGCTGCACCGAAATTGAATCTGGCGGGCGCATGGTTGATGCTATCCTGACA
AATACACTACTGCCACAAATCAGCCAGCAACTGCTTTTTGCCTCCACCCGTGATAAACAATATCGCCAAT
TAAACGTATTTCTTGACCAAGGTGAATTTCAATTTGAGTTTATGGATTAG