SecReT6
Protein ID: 300725291
SecReT6 ID399
T6SS typei1
Gene symbol-
Locus tagXNC1_4538
StrainXenorhabdus nematophila ATCC 19061
Repliconchromosome [GenBank: NC_014228] [Browse all T6SS(s) in this replicon]
Location [Strand]4336814..4338214 [-]
Producthypothetical protein
NoteTssA
UniProt IDD3VFA3
KEGG IDxne:XNC1_4538
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 9.00E-44, Aligned region: 91..154
DUF3702 [PF12486], Evalue: 9.00E-44, Aligned region: 291..438
ImpA-rel_N [PF06812], Evalue: 1.50E-21, Aligned region: 41..101
ImpA-rel_N [PF06812], Evalue: 1.50E-21, Aligned region: 311..322
Protein Sequence: 466 a.a.     [Download]
>gi|300725291|ref|YP_003714622.1| unnamed protein product [Xenorhabdus nematophila ATCC 19061]
MSGHPENLIIRAGGSPLNLPEFAVIRDEINKTSHPAQPEVNWPLVESLSLTLFKTNGVDLQTAIYYTLAR
MQLNGLAGFTEGCELLAGVIVSEWDTLWPPQPQVRTDLLEWFHTRTGSALRQQDFAASDLRMIYRAERAL
QLIIDRLQQSDLKRLPRVENLLWFFQNAAKKLEKPRQAAKPAAPPVQMPPLVYLSASEAEPDIPPPSPPP
RHEPQPMPETQPRVRVQFPAPPPQGMSAWQGFGFGALLGVLVLVGSWLLFYKPLQQQLNALTGQPAGARL
AWLYQPELDSYAQQLERLAETGPLATWEAARTLTDTAEQLWPSAPAQRQATRQWEQAMTARIDSAPLKGS
WNTTRDQLQQLADKILLQERTRGSFTLSYLKTAIYDIQRSHGSDVPLEEQLRQLSVYAAKGDSAPPVLLK
GIDDRFNALLGRYDRLRQATDRHAGEPAEERQPLHREPAVTADGGH
 
Nucleotide Sequence: 1401 bp     [Download]
>gi|300721089|ref|NC_014228.1|:c4338214-4336814 Xenorhabdus nematophila ATCC 19061 chromosome, complete genome
ATGAGCGGACACCCTGAAAATCTCATCATCCGGGCGGGCGGCAGTCCGCTGAACCTGCCGGAATTTGCCG
TTATCCGCGATGAAATCAACAAAACCAGCCACCCGGCGCAACCGGAAGTCAACTGGCCACTGGTGGAATC
CCTGTCCCTGACCCTGTTCAAAACCAACGGGGTTGATTTACAGACTGCGATTTATTACACCCTGGCCCGG
ATGCAGCTCAATGGCCTGGCGGGATTCACCGAAGGCTGCGAACTGCTGGCGGGGGTGATTGTCAGTGAAT
GGGATACCTTGTGGCCGCCCCAGCCGCAAGTCCGCACTGACCTGCTGGAATGGTTCCACACCCGGACCGG
CAGCGCCCTGCGCCAGCAGGATTTTGCCGCCAGCGACCTGCGGATGATTTACCGGGCCGAACGGGCACTC
CAGCTGATCATTGACCGGTTGCAGCAATCCGACCTGAAACGCCTGCCGCGGGTGGAAAACCTGCTGTGGT
TCTTCCAGAACGCGGCCAAAAAACTGGAGAAACCGCGTCAGGCCGCGAAACCCGCCGCGCCGCCAGTGCA
GATGCCGCCGCTGGTCTACCTGTCCGCGTCTGAGGCCGAGCCGGACATTCCCCCGCCTTCCCCGCCCCCG
CGTCATGAACCCCAGCCGATGCCCGAAACTCAACCACGGGTGCGGGTGCAGTTTCCGGCTCCACCGCCGC
AGGGGATGAGTGCCTGGCAGGGCTTTGGCTTCGGTGCATTGCTGGGGGTACTGGTGTTGGTGGGCAGCTG
GCTGCTGTTTTACAAACCGCTGCAACAACAACTGAACGCCCTCACCGGTCAGCCGGCGGGGGCACGGCTG
GCCTGGCTGTACCAGCCTGAGCTGGACAGCTATGCGCAGCAGCTTGAGCGGCTGGCGGAAACCGGGCCGC
TGGCAACCTGGGAGGCCGCCCGTACCCTGACGGACACTGCGGAACAGTTATGGCCGTCGGCACCGGCTCA
GCGGCAGGCGACCCGCCAATGGGAACAGGCCATGACCGCCCGTATCGACAGTGCCCCGCTGAAAGGCAGC
TGGAACACCACCCGTGACCAGCTCCAGCAACTGGCGGACAAAATCCTGTTACAGGAACGGACCCGTGGCA
GTTTCACGCTGTCCTACCTGAAAACCGCCATCTACGACATCCAGCGCAGCCACGGCAGTGACGTCCCGCT
GGAAGAACAGCTGCGTCAGTTGAGCGTCTATGCGGCAAAAGGGGACAGTGCCCCGCCGGTGTTGCTGAAA
GGCATCGATGACCGCTTTAACGCGCTGCTGGGCCGGTATGACCGGCTGCGTCAGGCCACAGACCGTCATG
CCGGGGAGCCAGCCGAAGAACGCCAGCCCCTACATCGTGAACCAGCCGTCACCGCGGACGGTGGGCATTA
A