SecReT6
Protein ID: 300725293
SecReT6 ID399
T6SS typei1
Gene symbol-
Locus tagXNC1_4540
StrainXenorhabdus nematophila ATCC 19061
Repliconchromosome [GenBank: NC_014228] [Browse all T6SS(s) in this replicon]
Location [Strand]4341899..4343341 [-]
Producthypothetical protein
NoteTssA
UniProt IDD3VFA5
KEGG IDxne:XNC1_4540
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.10E-16, Aligned region: 52..112
ImpA-rel_N [PF06812], Evalue: 1.10E-16, Aligned region: 150..159
ImpA-rel_N [PF06812], Evalue: 1.10E-16, Aligned region: 392..404
Protein Sequence: 480 a.a.     [Download]
>gi|300725293|ref|YP_003714624.1| unnamed protein product [Xenorhabdus nematophila ATCC 19061]
MDIRTQFDWFGSLLAPLSDEQIGKALGDSDPAWEYIDSEMIKFGSLSHGSLDVDEIRRQALQLLSENSKD
FRLMVHLLRTLQHAGNAAELILATELLTEYVKNYWEKAWPVKPLMKRRLAQQVLKRFDSAQGSFTEQASK
NERDDAQGALAHLAQCWHVNEPELAKEVDQLRTRYSRQPETVPEAPKPAPVAAPTSTTESSVSTPQSYEA
APMPEVDVNSSSEKAWKQTLLTVSDLLCERHPESPVGYSLRRHAVWHTLTTAPMANATGKTPLAPASADR
TADYLARLPTANNKLLQQIEQSLTLAPYWLDGHAIAAQTALQLGYVNVALAIRDELNAFLDRLPVLKTLS
FSDMSPFISPETLDWLAPEPVATGKGAVSADQEAIWQCFAQQGLEAALKMLEEHQQQLTEPRDQFYGQLL
NAHLLEEAGMTSLAQQHYRNLLHTGQHMLLTQWEPSLLALLADKLPSPSSEPASNRSVNP
 
Nucleotide Sequence: 1443 bp     [Download]
>gi|300721089|ref|NC_014228.1|:c4343341-4341899 Xenorhabdus nematophila ATCC 19061 chromosome, complete genome
ATGGACATCAGAACACAATTCGACTGGTTCGGCTCCCTGCTGGCCCCTTTGTCCGACGAACAGATTGGCA
AGGCGCTGGGCGACAGTGACCCTGCATGGGAATACATTGACAGCGAAATGATCAAGTTTGGTTCGCTGTC
GCATGGTTCGCTGGATGTTGACGAGATCCGGCGACAGGCATTGCAGCTGCTGAGTGAAAACAGTAAAGAT
TTCCGGCTGATGGTCCATCTGTTGCGAACCCTGCAACATGCCGGTAACGCGGCTGAATTGATCCTCGCCA
CAGAGTTACTGACCGAGTATGTCAAAAACTACTGGGAAAAGGCCTGGCCGGTCAAGCCGCTCATGAAACG
CCGGCTGGCGCAGCAGGTACTCAAGCGTTTTGACTCGGCTCAGGGCAGTTTCACCGAACAGGCGAGCAAA
AATGAACGGGATGATGCGCAAGGTGCGTTAGCCCATCTTGCGCAATGCTGGCATGTGAATGAACCAGAAC
TTGCCAAAGAAGTCGATCAACTGCGCACGCGTTACAGTCGTCAGCCAGAAACGGTGCCAGAGGCACCAAA
ACCGGCACCTGTGGCTGCGCCGACATCGACAACAGAATCTTCGGTATCAACGCCGCAATCCTATGAAGCA
GCACCCATGCCAGAAGTGGATGTTAACAGCTCAAGCGAAAAAGCGTGGAAACAAACTCTGCTGACCGTGT
CTGATTTGCTGTGTGAACGACATCCTGAGTCGCCTGTCGGCTATTCCCTGCGACGCCATGCAGTCTGGCA
TACCCTCACCACGGCACCGATGGCGAATGCAACGGGTAAAACCCCACTGGCACCGGCTTCTGCTGATCGT
ACCGCCGATTATCTGGCGAGATTACCGACGGCGAATAACAAATTGCTCCAGCAAATTGAGCAAAGCCTGA
CGCTGGCACCTTACTGGCTGGATGGTCATGCGATCGCTGCGCAGACGGCGTTGCAATTGGGTTATGTGAA
CGTCGCACTGGCCATTCGTGACGAACTGAATGCTTTTCTGGATCGATTGCCGGTGCTGAAAACCTTAAGT
TTTTCCGACATGAGTCCGTTTATTTCTCCGGAGACGCTCGATTGGCTGGCACCTGAACCCGTCGCAACGG
GTAAAGGCGCAGTTTCTGCTGATCAGGAAGCTATCTGGCAGTGCTTCGCGCAACAGGGATTGGAAGCTGC
CCTGAAAATGTTGGAAGAACACCAGCAACAGCTTACTGAGCCACGCGATCAATTTTACGGTCAATTACTC
AATGCTCACTTGCTTGAAGAAGCAGGTATGACGTCGTTGGCCCAACAGCATTACCGGAACTTGTTACACA
CGGGACAACACATGTTACTCACTCAATGGGAACCCAGCCTACTGGCTTTACTGGCTGACAAACTGCCTTC
TCCTTCTTCGGAACCGGCTTCAAACAGGAGCGTTAACCCATGA