SecReT6
Protein ID: 300725296
SecReT6 ID399
T6SS typei1
Gene symbol-
Locus tagXNC1_4544
StrainXenorhabdus nematophila ATCC 19061
Repliconchromosome [GenBank: NC_014228] [Browse all T6SS(s) in this replicon]
Location [Strand]4344812..4347547 [-]
ProductClpA/B-type chaperone
NoteTssH
UniProt IDD3VFA9
KEGG IDxne:XNC1_4544
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.70E-40, Aligned region: 223..327
AAA_2 [PF07724], Evalue: 3.70E-40, Aligned region: 646..807
AAA [PF00004], Evalue: 1.10E-19, Aligned region: 223..334
AAA [PF00004], Evalue: 1.10E-19, Aligned region: 581..607
AAA [PF00004], Evalue: 1.10E-19, Aligned region: 652..772
AAA_5 [PF07728], Evalue: 9.20E-15, Aligned region: 223..249
AAA_5 [PF07728], Evalue: 9.20E-15, Aligned region: 651..771
ClpB_D2-small [PF10431], Evalue: 2.40E-14, Aligned region: 813..887
AAA_16 [PF13191], Evalue: 5.00E-11, Aligned region: 200..243
AAA_16 [PF13191], Evalue: 5.00E-11, Aligned region: 253..301
AAA_16 [PF13191], Evalue: 5.00E-11, Aligned region: 622..688
AAA_16 [PF13191], Evalue: 5.00E-11, Aligned region: 717..745
AAA_16 [PF13191], Evalue: 5.00E-11, Aligned region: 809..847
AAA_22 [PF13401], Evalue: 1.10E-07, Aligned region: 222..308
AAA_22 [PF13401], Evalue: 1.10E-07, Aligned region: 362..389
AAA_22 [PF13401], Evalue: 1.10E-07, Aligned region: 650..670
AAA_22 [PF13401], Evalue: 1.10E-07, Aligned region: 713..745
NACHT [PF05729], Evalue: 6.20E-05, Aligned region: 223..250
NACHT [PF05729], Evalue: 6.20E-05, Aligned region: 417..451
NACHT [PF05729], Evalue: 6.20E-05, Aligned region: 652..679
NACHT [PF05729], Evalue: 6.20E-05, Aligned region: 854..881
AAA_14 [PF13173], Evalue: 6.90E-05, Aligned region: 223..313
AAA_14 [PF13173], Evalue: 6.90E-05, Aligned region: 651..739
DUF258 [PF03193], Evalue: 0.00015, Aligned region: 187..240
DUF258 [PF03193], Evalue: 0.00015, Aligned region: 652..667
AAA_25 [PF13481], Evalue: 0.0002, Aligned region: 223..245
AAA_25 [PF13481], Evalue: 0.0002, Aligned region: 646..680
AAA_29 [PF13555], Evalue: 0.00034, Aligned region: 216..239
AAA_29 [PF13555], Evalue: 0.00034, Aligned region: 649..673
AAA_19 [PF13245], Evalue: 0.00084, Aligned region: 220..244
AAA_19 [PF13245], Evalue: 0.00084, Aligned region: 579..593
AAA_19 [PF13245], Evalue: 0.00084, Aligned region: 645..670
Zeta_toxin [PF06414], Evalue: 0.0019, Aligned region: 59..82
Zeta_toxin [PF06414], Evalue: 0.0019, Aligned region: 223..241
Zeta_toxin [PF06414], Evalue: 0.0019, Aligned region: 650..691
Sigma54_activat [PF00158], Evalue: 0.0026, Aligned region: 222..239
Sigma54_activat [PF00158], Evalue: 0.0026, Aligned region: 651..750
Arch_ATPase [PF01637], Evalue: 0.008, Aligned region: 203..243
Arch_ATPase [PF01637], Evalue: 0.008, Aligned region: 527..565
Arch_ATPase [PF01637], Evalue: 0.008, Aligned region: 652..672
Arch_ATPase [PF01637], Evalue: 0.008, Aligned region: 722..733
Ras [PF00071], Evalue: 0.0086, Aligned region: 223..236
Ras [PF00071], Evalue: 0.0086, Aligned region: 652..692
Protein Sequence: 911 a.a.     [Download]
>gi|300725296|ref|YP_003714628.1| unnamed protein product [Xenorhabdus nematophila ATCC 19061]
MIQIDLPTLVNRLNPMTRHALEAAAASCVSQQQPEITVAQLLFQMIDTPLSDVRLILNKVDIDKDLLKEQ
LNQVMHHHQSIVQTYPNFSPMLVEWLQDSWLLASTEMQHSELRSGVMLIALLFSPMRYLAPQTARLLAGI
NRELLRQNFVEWTHGSAEQPFTAGDEKDGQGVHPANSDSLLARFTQNMTEQARKGKLDPVLCRDNEIDLM
IDILCRRRKNNPIVVGEAGVGKSALIEGLALRIINDRVPDKLRNSELMTLDLGALQAGAAVKGEFEKRFK
GIMTEISQSAKPIILFIDEAHTLIGAGNQAGGLDISNLLKPALARGELKTIAATTWSEYKKYFEKDAALS
RRFQLVKVSEPTADEATVIMRGLRAIYEQAHGVLIDDEALKASAVLSDRYLSGRQLPDKAIDVLDTACAR
VAINLTSPPRQVSSLTTELHQMQMEIDVLGREQRMGLNTHAERLEELQNQQAEIQAQLAELEASWKQQQE
LVTQIIALRSQLLSDDDSAEAKTADAIPAETAELVAENTEENETVEPAETVVETTAEISVDDEKSAIEKL
AELNIQLAELQQKQTLVSPHVDKTQIAAVIAEWTGVPLNRLSQSELSIVTELPVHLGYNIKGQETAIQCL
HKHLLTARADLRRPGRPLGAFLLVGPSGVGKTETVLQIAELMFGGRQYLTTINMSEFQEKHTVSRLIGSP
PGYVGYGEGGVLTEAIRQKPYSVVLLDEVEKAHPDVLNLFYQAFDKGELADGEGRTIDCKNVVFFLTSNL
GYQTIVDNAEQPDQLNDLLYPELAAFFKPALLARMEVIPYLPLGHETLKTIIQGKLARLDTLLTQRFNAE
VTISDDVSEEILQRATRAENGARMLESIIDGALLPPVSLLLLQKMAAGTPIKAIRLTVAEHEFRAEVEEA
E
 
Nucleotide Sequence: 2736 bp     [Download]
>gi|300721089|ref|NC_014228.1|:c4347547-4344812 Xenorhabdus nematophila ATCC 19061 chromosome, complete genome
ATGATCCAGATTGATCTGCCCACTCTTGTAAATCGTTTAAACCCGATGACCCGCCATGCACTGGAAGCGG
CGGCAGCATCTTGTGTCAGCCAGCAGCAGCCTGAAATTACCGTTGCACAACTGCTGTTTCAAATGATCGA
CACACCGCTCAGTGACGTGAGACTGATCCTGAATAAAGTTGATATTGATAAAGATCTGCTGAAAGAACAG
CTCAATCAGGTGATGCATCATCATCAATCGATTGTACAGACTTACCCTAATTTCTCCCCGATGCTGGTGG
AGTGGTTGCAGGATAGCTGGCTGTTGGCATCGACAGAGATGCAGCACTCAGAACTGCGCAGCGGCGTGAT
GCTGATTGCGTTGCTGTTCAGCCCGATGCGTTATCTGGCGCCACAAACGGCACGTTTGTTGGCGGGCATT
AACCGCGAGTTGCTGCGTCAAAACTTTGTGGAATGGACCCATGGTTCTGCCGAGCAGCCTTTTACGGCTG
GCGATGAGAAAGATGGACAAGGCGTACATCCGGCAAACAGCGACAGTCTGCTGGCTCGCTTTACCCAGAA
CATGACCGAGCAGGCTCGCAAGGGCAAACTCGACCCCGTGCTGTGCCGCGACAATGAAATCGATCTGATG
ATCGACATTCTCTGCCGCCGCCGCAAAAACAACCCGATTGTTGTGGGTGAAGCGGGTGTCGGTAAAAGTG
CCCTGATTGAAGGTCTGGCGCTGCGTATTATTAACGATCGCGTACCGGATAAATTGCGCAACAGTGAACT
GATGACGCTGGATCTGGGTGCATTGCAGGCCGGCGCGGCGGTGAAAGGTGAATTTGAAAAACGTTTCAAA
GGCATCATGACCGAAATCAGCCAGTCAGCAAAACCGATCATTCTGTTCATTGATGAAGCCCATACGCTGA
TTGGGGCAGGTAACCAAGCGGGCGGACTGGATATCTCCAACCTGCTGAAACCGGCACTGGCACGCGGCGA
ACTGAAAACCATCGCGGCAACCACCTGGAGCGAGTACAAAAAATATTTCGAAAAAGACGCGGCATTGTCC
CGTCGTTTCCAGCTGGTGAAAGTTTCTGAGCCGACGGCAGATGAAGCAACCGTGATCATGCGTGGTCTGC
GTGCCATTTATGAGCAGGCGCATGGCGTACTGATTGATGATGAAGCACTGAAAGCCTCCGCGGTACTGAG
TGACCGTTACCTTTCAGGCCGTCAACTGCCGGATAAAGCGATTGACGTACTGGATACCGCCTGTGCGCGT
GTTGCCATTAACCTGACTTCACCACCACGCCAAGTCTCCTCGCTGACGACCGAATTGCACCAGATGCAAA
TGGAAATCGACGTGTTGGGGAGAGAGCAACGCATGGGGCTGAACACCCACGCGGAGCGACTGGAAGAACT
GCAAAACCAGCAGGCAGAGATTCAGGCACAACTGGCTGAACTGGAAGCAAGCTGGAAACAGCAGCAGGAG
TTGGTCACTCAGATCATCGCACTGCGCAGCCAACTGCTGTCTGATGATGACTCTGCGGAAGCAAAAACAG
CCGACGCTATTCCGGCAGAGACGGCTGAGCTGGTTGCCGAAAATACAGAAGAAAATGAAACTGTTGAGCC
AGCTGAAACCGTCGTTGAAACCACGGCTGAAATCTCGGTTGATGATGAAAAATCCGCGATTGAAAAACTC
GCAGAGCTGAACATTCAGTTGGCAGAACTACAGCAAAAACAAACGCTGGTTTCCCCGCATGTGGATAAAA
CCCAGATTGCTGCGGTGATTGCTGAGTGGACAGGGGTTCCGTTGAACCGCCTGTCACAAAGCGAACTGTC
TATCGTCACTGAACTGCCTGTTCATCTGGGGTACAACATCAAAGGGCAGGAAACGGCGATCCAGTGCCTG
CACAAACACCTGCTGACCGCCCGTGCAGACCTGCGTCGGCCTGGTCGTCCTCTGGGGGCATTCCTGCTGG
TGGGACCCAGCGGTGTCGGTAAAACCGAAACGGTCCTGCAAATTGCAGAGCTGATGTTCGGTGGTCGCCA
ATACCTCACGACGATCAACATGTCTGAGTTTCAGGAGAAACACACCGTTTCCCGCCTGATCGGTTCACCT
CCGGGTTATGTCGGTTACGGTGAAGGCGGTGTGCTGACTGAAGCTATTCGTCAGAAACCCTATTCCGTCG
TCTTGCTGGACGAAGTCGAAAAAGCGCACCCGGATGTCTTGAACCTGTTCTATCAGGCTTTCGATAAAGG
GGAACTGGCGGATGGAGAAGGGCGTACCATCGACTGTAAAAACGTCGTGTTCTTCCTGACCTCTAACTTG
GGTTATCAAACTATCGTAGACAATGCGGAGCAACCCGATCAGCTCAACGATCTACTTTACCCGGAGTTGG
CGGCCTTCTTCAAACCGGCTCTGTTGGCGCGTATGGAAGTGATCCCTTATCTGCCGTTGGGCCATGAAAC
ACTGAAAACCATCATTCAGGGCAAACTGGCCCGCCTGGACACGCTGCTGACTCAACGCTTCAACGCAGAG
GTCACCATCAGCGATGACGTCTCAGAAGAGATCCTGCAACGTGCTACCCGTGCAGAAAATGGTGCCCGTA
TGCTGGAATCCATCATTGATGGCGCACTGCTGCCACCAGTTTCATTACTGCTGTTGCAAAAAATGGCAGC
AGGGACACCGATTAAGGCCATTCGCTTAACCGTGGCAGAACACGAGTTCCGGGCAGAGGTTGAGGAGGCG
GAATAA