SecReT6
Protein ID: 300725297
SecReT6 ID399
T6SS typei1
Gene symbol-
Locus tagXNC1_4545
StrainXenorhabdus nematophila ATCC 19061
Repliconchromosome [GenBank: NC_014228] [Browse all T6SS(s) in this replicon]
Location [Strand]4347557..4348324 [-]
Producthypothetical protein
NoteTssL
UniProt IDD3VFB0
KEGG IDxne:XNC1_4545
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.40E-62, Aligned region: 34..239
Protein Sequence: 255 a.a.     [Download]
>gi|300725297|ref|YP_003714629.1| unnamed protein product [Xenorhabdus nematophila ATCC 19061]
MSDINVDSLSLEKPETLKTFQRQYQLPLRGESLNPMIDAATPLLGMVLRLQDMNDQALPDKLYQQVVTDI
RAIEQFLQTKGYEPGAIVSFRYVLCTFIDETALGHGWNSQNGWLKQSLLVHFHNETWGGEKVFVLLERLM
GEVQRYQHLLEFIYLCLCLGYRGRYKVSTQKSDDFERLFRRLQQQLHSLRGETPPTTLYVNINESDARYR
LSRRWTIKHLLFISAGLLVAIYSFYAIRLGDQTQDILKQLSNLLR
 
Nucleotide Sequence: 768 bp     [Download]
>gi|300721089|ref|NC_014228.1|:c4348324-4347557 Xenorhabdus nematophila ATCC 19061 chromosome, complete genome
ATGAGTGATATCAATGTTGACAGTCTGTCACTGGAAAAACCTGAAACGTTAAAAACGTTTCAGCGCCAGT
ACCAGTTACCGTTGCGTGGTGAAAGCCTCAACCCAATGATCGATGCAGCCACCCCTTTACTGGGGATGGT
TTTGCGTTTGCAGGACATGAATGATCAGGCACTGCCGGACAAGCTTTACCAGCAGGTTGTGACTGATATC
CGGGCCATTGAACAGTTTCTGCAAACCAAGGGTTATGAACCCGGCGCGATTGTTTCATTTCGTTACGTAC
TGTGCACCTTCATTGATGAAACTGCATTGGGGCACGGTTGGAACAGCCAGAATGGCTGGTTGAAGCAATC
ACTGTTGGTGCACTTCCACAATGAAACCTGGGGAGGTGAGAAAGTCTTCGTATTGCTTGAACGCTTGATG
GGAGAGGTTCAGCGCTATCAGCACCTGCTGGAGTTCATTTATCTCTGCCTGTGTCTGGGCTACCGCGGCC
GTTACAAAGTCAGCACCCAGAAAAGTGATGATTTTGAACGCCTGTTCCGCCGCTTGCAGCAACAGCTTCA
CTCACTGCGCGGAGAAACGCCGCCAACCACGCTGTATGTCAATATCAACGAAAGTGATGCGCGTTACCGC
CTGAGCAGACGCTGGACTATCAAGCACCTGCTTTTTATCAGCGCGGGATTGTTAGTCGCCATTTACAGCT
TCTATGCCATCCGCCTCGGTGATCAGACACAAGACATATTGAAGCAGCTAAGTAACTTATTGAGATAG