SecReT6
Protein ID: 300725298
SecReT6 ID399
T6SS typei1
Gene symbol-
Locus tagXNC1_4546
StrainXenorhabdus nematophila ATCC 19061
Repliconchromosome [GenBank: NC_014228] [Browse all T6SS(s) in this replicon]
Location [Strand]4348327..4349679 [-]
Producthypothetical protein
NoteTssK
UniProt IDD3VFB1
KEGG IDxne:XNC1_4546
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.60E-153, Aligned region: 19..446
Protein Sequence: 450 a.a.     [Download]
>gi|300725298|ref|YP_003714630.1| unnamed protein product [Xenorhabdus nematophila ATCC 19061]
MPGKNRVIWHEGLFIKPQHFQQQQKHIDYLAHSLVSVLTPYAHGFSSLSINDDLLKLGRIGITEASGIMP
DGTLFAAPSQDLLPKPLDIENINDLKSKDIYLALPMSSDTIREIADRDAEIQSAVRYRELPTDVRDLHTK
GGDAFALNLAQLTPVLMQGSEDMSAYTAIPLCRIKEKQKDGNIVLDNEFIPTCLSIFVADKLKRFMVEID
GLLTERSRTLAKRIGSPGQQGVADVAEFMMLQLLNRVQPLFNHYAKQTVLHPLYLYTELLQTCGELRTFT
DASRLPGNVLAYDHNNLTDTFQDAMHAIRDALNVVLTPRATSIALKQNEGGIRVATLHDNDLLRKAEFVL
AISASTPQEQLRRQFVQQTKVTSMEKIRDLVSVQLPGVPLIALSAAPRQLPYHSGYTYFRLDQKSPAWKE
IQQGNSIAFHVSGDFPDLDMQLWAIRGGKE
 
Nucleotide Sequence: 1353 bp     [Download]
>gi|300721089|ref|NC_014228.1|:c4349679-4348327 Xenorhabdus nematophila ATCC 19061 chromosome, complete genome
ATGCCGGGTAAAAATCGGGTGATTTGGCACGAAGGATTATTCATCAAACCCCAACATTTTCAGCAACAAC
AAAAACACATTGATTATCTGGCGCATAGCCTGGTTTCCGTGCTGACACCTTATGCGCACGGTTTCAGCTC
CCTGAGCATCAATGATGATTTGCTTAAACTGGGCCGTATCGGGATCACCGAAGCCAGTGGCATTATGCCG
GATGGCACCCTATTTGCTGCGCCAAGTCAGGATTTGCTGCCAAAACCGCTGGATATCGAAAATATCAACG
ATCTGAAAAGCAAGGACATCTATCTGGCCTTGCCGATGTCCAGTGATACCATCCGGGAAATTGCTGATCG
GGATGCGGAAATACAGAGTGCCGTGCGTTATCGCGAGTTGCCGACGGATGTCCGTGACCTGCATACCAAA
GGCGGCGACGCCTTCGCGCTTAACCTTGCCCAATTGACGCCAGTCCTGATGCAAGGCTCCGAGGACATGA
GCGCTTATACCGCTATTCCGTTGTGCCGCATCAAAGAAAAGCAAAAAGATGGCAATATCGTGCTGGATAA
CGAATTTATTCCGACATGTTTGTCGATCTTTGTGGCGGATAAACTCAAGCGCTTTATGGTGGAAATTGAT
GGCCTGCTGACAGAGCGTTCAAGAACACTGGCTAAACGTATCGGTTCGCCGGGTCAGCAGGGGGTTGCGG
ATGTGGCTGAGTTTATGATGCTGCAATTACTGAACCGCGTTCAGCCGCTGTTCAACCATTATGCAAAACA
GACCGTTCTGCATCCTTTGTATCTCTATACCGAGTTGCTCCAGACTTGTGGCGAACTGAGAACGTTCACC
GATGCCAGCCGTTTGCCGGGCAATGTACTGGCATACGATCACAATAACCTGACGGATACCTTTCAGGATG
CGATGCACGCGATCCGTGACGCCCTGAACGTTGTTCTGACACCACGTGCAACGTCGATTGCACTGAAACA
GAACGAAGGCGGGATTCGTGTGGCAACGCTCCACGACAACGATCTGTTGCGCAAAGCCGAATTTGTACTG
GCAATCAGCGCCAGCACACCGCAGGAACAATTGCGTCGTCAGTTCGTCCAGCAAACTAAAGTCACTTCGA
TGGAAAAAATCCGCGATCTGGTCAGCGTACAGTTACCGGGCGTGCCACTGATTGCACTGTCCGCAGCGCC
TCGCCAGTTGCCGTACCACTCTGGATATACCTACTTCCGCCTGGATCAGAAGAGCCCGGCATGGAAAGAG
ATCCAGCAGGGAAATTCCATTGCATTCCACGTATCAGGGGATTTCCCTGATTTAGATATGCAGCTCTGGG
CTATCAGGGGCGGTAAGGAATAA