SecReT6
Protein ID: 300725300
SecReT6 ID399
T6SS typei1
Gene symbol-
Locus tagXNC1_4548
StrainXenorhabdus nematophila ATCC 19061
Repliconchromosome [GenBank: NC_014228] [Browse all T6SS(s) in this replicon]
Location [Strand]4350220..4351515 [-]
Producthypothetical protein
NoteFha
UniProt IDD3VFB3
KEGG IDxne:XNC1_4548
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 431 a.a.     [Download]
>gi|300725300|ref|YP_003714632.1| unnamed protein product [Xenorhabdus nematophila ATCC 19061]
MEKHQPILSLRVLNSEQLESGKAAGCQFSAQGGTVGSSESHLWSVQDQQGNVQPSQFAIKWQDGAFCLQV
FAEPVLINNAKLAPQSGLTRLQQGDQIKVGNLSVKIHISFSEADRTDPSTVSPESLVSSYSNPLDAMMEG
APAQKSAFAHDESIAPTVMHRFSDDPLRVLDSESLTTLKSQVEADDTEQLLPPDHYQSPPFANPISDNRG
SVMDQEFLDLPDIASDRQYEDMDVDHVAITPLMRGLETQLPLHDSQQANDFLQEMGKAMKAAIEGLLALQ
REQHGLRDKQLRPIEDNPLRLNMDYNTTMQVMFSDQKSPVHLSAPAAVAESLQNLQLHYQANRTAISAAL
DTMLEAFSPEQLLRRFSHYRRSNETRNKDASWAWEMYTNYYRELASSRQQGFEKLFREVYEQAYDRALRQ
GLEESSNDTFR
 
Nucleotide Sequence: 1296 bp     [Download]
>gi|300721089|ref|NC_014228.1|:c4351515-4350220 Xenorhabdus nematophila ATCC 19061 chromosome, complete genome
ATGGAAAAACATCAACCAATTCTTTCATTGCGGGTTCTGAACAGTGAACAGCTGGAAAGTGGTAAAGCCG
CCGGCTGTCAGTTCTCGGCACAGGGCGGTACGGTCGGTAGCAGTGAAAGCCACCTTTGGTCTGTGCAGGA
TCAGCAGGGTAATGTCCAGCCATCACAATTCGCCATCAAGTGGCAGGATGGCGCATTCTGCCTGCAAGTG
TTTGCTGAACCGGTGCTAATTAATAATGCAAAATTGGCACCTCAGTCGGGTTTAACCCGTTTGCAGCAAG
GTGATCAGATCAAAGTAGGAAACTTGTCTGTCAAGATCCACATCAGCTTCTCCGAGGCCGATCGCACCGA
TCCTTCAACCGTATCGCCTGAGTCATTGGTTTCCAGTTACAGCAACCCACTGGATGCCATGATGGAAGGT
GCTCCGGCCCAGAAATCTGCATTTGCCCATGATGAAAGCATCGCGCCAACCGTGATGCACCGTTTCAGTG
ATGATCCGCTCAGGGTACTCGACAGCGAGAGCCTGACCACACTGAAATCACAGGTTGAAGCTGACGATAC
AGAACAGCTTCTGCCACCGGATCATTATCAATCACCCCCGTTTGCCAACCCTATTTCTGATAACCGAGGC
AGTGTTATGGATCAGGAGTTCCTTGATTTACCGGATATCGCTTCCGATAGGCAGTACGAAGATATGGATG
TTGACCATGTCGCTATCACCCCGCTTATGCGTGGGTTGGAAACTCAGCTGCCTTTGCACGACAGCCAGCA
GGCGAATGATTTTCTGCAAGAGATGGGTAAGGCCATGAAAGCGGCGATTGAAGGATTATTGGCGCTTCAG
CGCGAACAGCACGGGCTGCGTGATAAACAGCTTCGCCCGATTGAAGATAACCCGCTGCGCCTGAACATGG
ATTATAACACCACCATGCAGGTGATGTTCTCCGATCAGAAAAGCCCGGTACACCTGTCCGCGCCTGCTGC
GGTAGCGGAAAGCCTGCAAAATTTGCAACTGCACTATCAGGCCAACCGCACGGCGATTTCCGCCGCGCTG
GATACCATGCTGGAAGCCTTTTCTCCGGAACAGTTGCTGCGTCGTTTCTCACATTACCGTCGTAGCAACG
AAACCAGAAATAAAGATGCGTCCTGGGCGTGGGAAATGTACACCAACTATTACCGTGAACTCGCATCCAG
CCGCCAGCAAGGGTTCGAAAAGCTATTCCGTGAAGTGTATGAGCAGGCTTATGACCGTGCACTACGTCAG
GGCTTGGAGGAATCCAGCAATGACACATTCCGCTAG