SecReT6
Protein ID: 300725301
SecReT6 ID399
T6SS typei1
Gene symbol-
Locus tagXNC1_4549
StrainXenorhabdus nematophila ATCC 19061
Repliconchromosome [GenBank: NC_014228] [Browse all T6SS(s) in this replicon]
Location [Strand]4351521..4352573 [-]
Producthypothetical protein
NoteTssG
UniProt IDD3VFB4
KEGG IDxne:XNC1_4549
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.50E-90, Aligned region: 26..337
Protein Sequence: 350 a.a.     [Download]
>gi|300725301|ref|YP_003714633.1| unnamed protein product [Xenorhabdus nematophila ATCC 19061]
MAGTDRSTLVDVITEQGLATPLALDISQYNFYQLVELLNQLAIAWEKTGETDRPDLESVRFRSSARLAFP
TRDVISLAQSKRGYFELEVSFMGLHGSQSPMPGYYLDSLAWEDAQGENRLTDFLNLFNHRLITLLHQIWR
KYRYYIYFKKGGEDSFSQRMFSLVGLGSDINRRMLNINHSKMLAYAGLLASPGRSPEVICSLVSHCFDLQ
DVTLHGWQFRKVTIPMDQQNRLGGTNKGQKIGDTELSVLGHNFTIGSWVGDYSGKFLLSINNLTRDRFLS
FLPDGKNYLPLVMFISFVMRSQFAWELRLGLAENQVSGMVLGAKENNHLGWTSFLGEPEKKPFVTISVME
 
Nucleotide Sequence: 1053 bp     [Download]
>gi|300721089|ref|NC_014228.1|:c4352573-4351521 Xenorhabdus nematophila ATCC 19061 chromosome, complete genome
ATGGCCGGTACAGATAGGTCAACACTCGTTGATGTAATCACTGAGCAGGGCCTTGCCACACCATTGGCAT
TGGACATCTCACAGTACAACTTTTACCAGTTGGTTGAGCTGCTTAACCAGCTTGCGATAGCGTGGGAAAA
AACCGGAGAAACAGATCGTCCCGATCTGGAGTCTGTCCGTTTCCGTTCCAGTGCCAGACTGGCATTCCCG
ACTCGTGATGTCATCTCACTCGCACAGTCCAAGCGGGGATACTTCGAACTGGAAGTTTCCTTTATGGGAT
TGCACGGTAGCCAGTCTCCGATGCCGGGTTACTATCTGGATTCACTGGCATGGGAAGACGCTCAGGGAGA
AAACCGCCTGACGGATTTTCTCAACCTTTTTAACCATCGCTTAATTACACTCCTGCATCAGATCTGGCGG
AAATACCGCTATTACATTTACTTCAAGAAAGGCGGGGAAGATAGCTTTTCCCAGCGCATGTTCTCGCTCG
TCGGTCTGGGCAGTGATATCAACCGCCGGATGCTGAACATTAATCACAGCAAAATGTTGGCCTATGCCGG
ATTGCTGGCAAGCCCCGGGCGTTCACCGGAAGTGATATGCAGCCTTGTTTCCCACTGTTTTGATTTGCAG
GACGTGACTTTACACGGTTGGCAATTCAGAAAGGTCACGATCCCGATGGATCAGCAAAACCGTCTGGGTG
GAACCAATAAGGGGCAGAAAATTGGTGACACGGAGCTATCTGTGTTGGGACACAACTTCACCATCGGCTC
ATGGGTTGGTGATTACAGCGGGAAATTCCTGCTGAGCATCAACAATTTGACCCGTGATCGGTTTCTGTCA
TTTCTGCCCGACGGCAAGAACTATCTCCCTCTGGTGATGTTCATCTCTTTCGTCATGCGCAGCCAGTTCG
CATGGGAACTGCGCCTTGGCCTGGCTGAAAATCAGGTCAGCGGCATGGTATTGGGGGCGAAGGAGAATAA
CCATCTGGGGTGGACCAGTTTTCTCGGCGAACCGGAAAAGAAACCCTTTGTCACAATTTCAGTTATGGAA
TAA