SecReT6
Protein ID: 300725302
SecReT6 ID399
T6SS typei1
Gene symbol-
Locus tagXNC1_4550
StrainXenorhabdus nematophila ATCC 19061
Repliconchromosome [GenBank: NC_014228] [Browse all T6SS(s) in this replicon]
Location [Strand]4352537..4354369 [-]
Producthypothetical protein
NoteTssF
UniProt IDD3VFB5
KEGG IDxne:XNC1_4550
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.10E-202, Aligned region: 3..610
Protein Sequence: 610 a.a.     [Download]
>gi|300725302|ref|YP_003714634.1| unnamed protein product [Xenorhabdus nematophila ATCC 19061]
MSFEKYFRDELNYLRQLGKEAAVERPHLAAFLSEQGSDPDVERLLEGFAFLTGNLRAKIDDQFPELTHGL
LNMLWPNYLRPTPSMTVIEYTPDESVVTKATQVKRGTQIMSHTLSDQDDIYSGEKADGKKDDHGRCTFTL
CRDVWLFPLSIRDISVNNSNENGIIGLNFASKTELNLHELELDKLRFYLSGDDYTTSQLYFWLCYYFRKA
ELVVGDKVIPLPDFDFVPVGFEREDALLPYPKNAYMGYRILQEYFCFAESFLFFDVKGFPTLPEDLKTKD
FKLNLHFSQALPPEAKIRDDTFRLHCTPAINLFPMDSEAIELNGSQTEYPLKASYSFPDNYDIFSVDGVE
SWLTGEKGERSRARIGERVYTPFESFNHQIDNEDEHSMRYYRLRVKESPFRRGLEHFISFVRGDESNLLR
LKLKENVSVRLTCTNREMPLELRVGDINYPSIGSPSFATFRNITRPSVPLYPLLDGGLHWSLLSNMSLNY
MSLLDKDALKQVLRTYDFPSIHNRQSKRSSQKRLDAIEKIETEPTDRLFRGQPVRGLRSTLYIRQQAFSS
EGELYLFSTILSRFFSLYASVNAFHMLKVINLDNQECYEWPVQIGQHSLM
 
Nucleotide Sequence: 1833 bp     [Download]
>gi|300721089|ref|NC_014228.1|:c4354369-4352537 Xenorhabdus nematophila ATCC 19061 chromosome, complete genome
ATGTCATTTGAAAAATATTTCAGAGATGAGTTGAATTATCTGCGACAACTGGGGAAAGAAGCCGCAGTTG
AGCGTCCTCATCTCGCCGCATTTCTGTCAGAACAAGGTTCTGATCCCGATGTTGAGCGTTTGCTTGAAGG
TTTTGCATTTCTGACCGGCAACTTGCGGGCAAAGATTGATGATCAATTCCCTGAATTGACCCACGGCTTG
CTCAATATGCTTTGGCCGAACTATCTGCGTCCGACTCCCAGCATGACTGTCATCGAGTATACCCCTGATG
AAAGCGTGGTGACGAAAGCGACACAGGTTAAGCGTGGCACACAGATTATGAGCCACACGCTGTCAGACCA
GGATGATATTTATTCGGGCGAAAAAGCCGATGGTAAAAAAGACGATCATGGTCGCTGTACTTTTACACTC
TGCCGCGATGTTTGGCTGTTTCCGCTTTCCATCCGTGATATTTCAGTCAATAACAGTAACGAAAACGGGA
TTATTGGTCTGAATTTTGCGTCGAAAACTGAGCTGAATCTGCACGAACTGGAACTGGACAAGCTGCGTTT
TTATCTCAGTGGTGATGACTATACGACGTCCCAGCTCTATTTCTGGCTCTGCTATTACTTTAGAAAAGCG
GAATTGGTGGTGGGCGATAAAGTAATCCCTCTCCCCGATTTTGATTTTGTACCGGTTGGATTTGAGCGCG
AAGACGCGCTGTTGCCTTACCCGAAAAATGCCTATATGGGATACCGCATTTTGCAGGAATATTTCTGTTT
TGCGGAAAGCTTCCTGTTCTTTGATGTGAAAGGTTTCCCGACACTGCCTGAAGATCTCAAAACCAAAGAT
TTTAAACTGAATTTACATTTTTCTCAGGCACTGCCGCCGGAAGCCAAGATCCGTGATGATACTTTCCGCC
TGCATTGTACACCGGCGATCAACCTGTTCCCGATGGACAGTGAAGCGATTGAACTCAATGGCAGCCAGAC
TGAATATCCCCTGAAGGCCAGTTACAGTTTTCCGGATAACTACGATATTTTCTCGGTCGATGGCGTGGAA
AGCTGGCTGACAGGTGAGAAAGGCGAACGCAGTCGTGCCCGTATTGGTGAGCGTGTTTATACGCCGTTTG
AAAGTTTCAATCATCAGATTGATAACGAAGACGAACACTCAATGCGTTATTACCGCCTGCGGGTGAAAGA
ATCTCCTTTCCGCAGGGGACTGGAACATTTCATCTCATTTGTACGCGGGGATGAATCCAATCTGCTCAGA
CTCAAGCTGAAAGAGAATGTCTCTGTCAGATTGACTTGTACCAACCGTGAAATGCCGTTAGAGCTGCGGG
TTGGCGACATCAATTATCCTTCCATCGGCAGTCCGTCATTTGCGACATTCCGTAATATCACGCGGCCGTC
AGTGCCTCTTTATCCTCTGTTAGATGGTGGATTGCACTGGTCATTGCTGTCAAATATGTCGCTGAACTAT
ATGTCATTACTGGATAAGGATGCGCTGAAACAGGTACTGCGTACCTACGATTTTCCCAGTATTCACAACC
GGCAGTCTAAACGCTCATCGCAGAAACGGCTTGATGCCATTGAAAAGATTGAAACAGAACCGACTGACCG
TCTGTTCCGCGGGCAGCCTGTGCGTGGATTGCGCTCAACGCTGTATATCCGGCAGCAGGCATTCAGCTCA
GAAGGTGAGCTTTATCTGTTCAGTACGATTCTGTCACGGTTTTTCTCACTGTATGCCAGCGTCAACGCTT
TTCATATGTTGAAGGTAATCAATTTAGATAATCAGGAATGTTATGAATGGCCGGTACAGATAGGTCAACA
CTCGTTGATGTAA