SecReT6
Protein ID: 300725303
SecReT6 ID399
T6SS typei1
Gene symbol-
Locus tagXNC1_4551
StrainXenorhabdus nematophila ATCC 19061
Repliconchromosome [GenBank: NC_014228] [Browse all T6SS(s) in this replicon]
Location [Strand]4354370..4354810 [-]
Producthypothetical protein
NoteTssE
UniProt IDD3VFB6
KEGG IDxne:XNC1_4551
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.00E-19, Aligned region: 31..122
Protein Sequence: 146 a.a.     [Download]
>gi|300725303|ref|YP_003714635.1| unnamed protein product [Xenorhabdus nematophila ATCC 19061]
MAALYSWNRGSSASLFERIQGKGSGSSRQSRMRALLDSIRNHLNEVLNSRPGACQSAVDLGVIDLNDATA
TSVDFKQSIEWAIEDCIRNYEPRISAVSVSAINDDSDPLLLSFHISAEISLDDINDLVEFSIQLDNNRRY
CLERSQ
 
Nucleotide Sequence: 441 bp     [Download]
>gi|300721089|ref|NC_014228.1|:c4354810-4354370 Xenorhabdus nematophila ATCC 19061 chromosome, complete genome
ATGGCTGCGCTGTACAGTTGGAACAGAGGCAGCTCTGCCAGTCTGTTTGAGCGCATTCAAGGGAAGGGCT
CCGGCTCTTCCCGTCAGTCAAGGATGCGTGCACTGCTTGATTCTATCAGGAATCATTTGAATGAAGTGCT
TAATTCCCGTCCCGGTGCCTGCCAAAGCGCTGTTGACTTAGGTGTCATTGATCTCAATGACGCAACTGCG
ACATCGGTGGATTTCAAGCAAAGTATCGAATGGGCGATTGAAGACTGCATCAGAAATTATGAACCGAGAA
TATCAGCGGTTTCTGTCAGCGCCATCAATGATGATTCGGACCCGTTGCTGTTGAGCTTTCATATCAGTGC
TGAAATTTCTCTGGATGATATCAACGACCTTGTGGAATTTAGCATCCAGTTGGATAACAACCGGCGCTAT
TGCCTGGAGCGATCTCAATAA