SecReT6
Protein ID: 300725304
SecReT6 ID399
T6SS typei1
Gene symbol-
Locus tagXNC1_4552
StrainXenorhabdus nematophila ATCC 19061
Repliconchromosome [GenBank: NC_014228] [Browse all T6SS(s) in this replicon]
Location [Strand]4354813..4356291 [-]
Producthypothetical protein
NoteTssC
UniProt IDD3VFB7
KEGG IDxne:XNC1_4552
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.90E-187, Aligned region: 65..490
Protein Sequence: 492 a.a.     [Download]
>gi|300725304|ref|YP_003714636.1| unnamed protein product [Xenorhabdus nematophila ATCC 19061]
MAQHEENSTAIASGATTSLLDEIMSQARMTPENDGYYIAKQGVAAFIGSILDTGSNEEPINKLLVDKMIV
ELDKKLSEQMDEILHAQQFQELESSWRSLKILVDRTDFRENIKINVIHATKDELLEDFEFSPEIIQSGFY
KHVYSTGYGQFGGEPVAAVIGNYAFSNTSPDIKLMQYVSSVGAMAHAPFLSSVSPEFFGVNSFTDLPAIK
DLKSVFEGPSHTKWRALRESEDSRYLGLTAPRFLLRLPYSSVENPIKNFNYQENVSRDHDHFLWGNTAYL
LASCLTDSFAKYRWCPNIIGPQSGGAVSDLPVHLYEAMGQVQAKIPTEVLITDRREFELAEEGFITLTMR
KGSDNAAFFSANSVQKPKVFPNTREGKIAETNYKLGTQLPYMFIINRLAHYIKVLQREQIGSWKERQDLE
RELNMWLKQYIADQENPPTDVRSRRPLRAAEIKVLDVEGDPGWYQVAMQVRPHFKYMGASFELSLVGRLD
KE
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|300721089|ref|NC_014228.1|:c4356291-4354813 Xenorhabdus nematophila ATCC 19061 chromosome, complete genome
ATGGCTCAGCACGAAGAAAACAGCACAGCTATTGCTTCTGGCGCAACGACCTCTTTGCTTGATGAGATTA
TGTCCCAGGCAAGAATGACCCCGGAAAATGACGGCTACTATATTGCTAAGCAGGGTGTTGCTGCGTTTAT
CGGCAGCATTCTGGATACGGGCTCTAACGAAGAACCCATTAACAAACTGCTCGTTGATAAAATGATCGTA
GAGCTGGATAAAAAGCTGAGTGAGCAGATGGATGAAATTCTGCACGCTCAGCAATTCCAGGAACTGGAAT
CTTCCTGGCGTTCACTGAAGATTCTGGTGGATCGCACAGATTTCCGTGAAAACATTAAAATCAACGTCAT
TCATGCGACTAAAGATGAACTGTTGGAAGATTTTGAGTTTTCTCCTGAAATTATCCAGTCCGGCTTCTAC
AAGCACGTTTATTCCACAGGTTACGGTCAGTTCGGTGGTGAACCTGTTGCTGCCGTCATCGGTAACTATG
CGTTCAGCAACACCTCGCCAGACATTAAACTGATGCAGTATGTCAGCTCTGTTGGTGCAATGGCTCATGC
GCCATTCCTGTCTTCCGTTTCTCCGGAATTCTTTGGGGTTAACAGCTTTACTGACCTGCCAGCCATCAAG
GATCTGAAGTCTGTCTTTGAAGGCCCTTCACATACTAAATGGCGTGCGCTGCGTGAGTCTGAAGACTCAC
GTTACTTAGGCCTGACTGCACCGCGTTTCCTGCTGCGTCTGCCTTATTCCAGCGTTGAAAATCCAATCAA
AAACTTCAACTATCAGGAAAATGTCAGCCGCGACCACGATCACTTCCTGTGGGGTAACACGGCCTACCTG
TTGGCAAGCTGCCTGACTGACAGCTTCGCTAAATATCGCTGGTGCCCGAATATCATCGGTCCACAGAGCG
GTGGTGCAGTAAGCGATCTGCCTGTTCACCTGTATGAAGCAATGGGCCAGGTTCAGGCGAAGATCCCAAC
GGAAGTTCTGATCACTGACCGCCGTGAATTTGAATTGGCAGAAGAAGGTTTCATCACCCTGACTATGCGT
AAAGGCAGCGATAACGCCGCATTCTTCTCCGCAAACTCGGTGCAGAAACCAAAAGTATTCCCGAATACCC
GTGAAGGGAAAATTGCGGAAACCAACTATAAGTTGGGTACGCAGCTTCCGTACATGTTCATCATCAACCG
TCTGGCTCACTACATCAAAGTGTTGCAGCGTGAACAGATCGGCTCCTGGAAAGAGCGTCAGGATCTGGAG
CGTGAACTGAACATGTGGCTGAAACAGTACATTGCTGATCAGGAAAACCCACCCACTGACGTTCGTAGTC
GTCGTCCTCTGCGTGCCGCTGAAATTAAGGTTTTGGACGTGGAAGGCGATCCAGGCTGGTATCAGGTTGC
TATGCAGGTTCGCCCACACTTCAAATACATGGGTGCAAGCTTCGAACTGTCTCTGGTCGGGCGTTTGGAT
AAGGAATAA