SecReT6
Protein ID: 300725305
SecReT6 ID399
T6SS typei1
Gene symbol-
Locus tagXNC1_4553
StrainXenorhabdus nematophila ATCC 19061
Repliconchromosome [GenBank: NC_014228] [Browse all T6SS(s) in this replicon]
Location [Strand]4356311..4356808 [-]
Producthypothetical protein
NoteTssB
UniProt IDD3VFB8
KEGG IDxne:XNC1_4553
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.00E-58, Aligned region: 8..160
Protein Sequence: 165 a.a.     [Download]
>gi|300725305|ref|YP_003714637.1| unnamed protein product [Xenorhabdus nematophila ATCC 19061]
MSKNSPGSVAPKERINIKYVPNTGDQTAEVELPLNLLVVGDLKGKTEDTPIEERQTVSINKNNFNAVMNE
ANINLTFNVPNRLDEKSEEDLPVNLEIKSLSDFSPDNVAKKVPELNKLLELREALVALKGPLGNIPAFRS
RLQSLLDDESVREQLLKELEIVNKK
 
Nucleotide Sequence: 498 bp     [Download]
>gi|300721089|ref|NC_014228.1|:c4356808-4356311 Xenorhabdus nematophila ATCC 19061 chromosome, complete genome
ATGAGTAAGAATAGTCCAGGTAGCGTAGCTCCGAAAGAAAGAATTAACATTAAATATGTTCCTAATACCG
GTGACCAGACCGCAGAAGTTGAATTACCGCTGAATCTTCTGGTTGTTGGTGACTTGAAAGGAAAGACCGA
AGATACGCCAATTGAAGAACGGCAAACAGTTTCTATTAATAAGAACAATTTCAATGCGGTCATGAATGAG
GCGAACATCAACCTGACTTTCAACGTCCCTAACCGCCTTGATGAAAAAAGCGAAGAAGATCTGCCAGTTA
ATCTGGAAATAAAATCACTGAGCGATTTTTCCCCTGATAATGTCGCGAAGAAAGTCCCTGAATTAAATAA
ACTTCTTGAACTTCGTGAAGCATTAGTTGCACTAAAAGGTCCATTAGGAAATATCCCGGCATTTCGTTCC
CGCTTGCAGTCACTGTTGGATGATGAATCCGTTCGTGAGCAACTCCTGAAAGAACTTGAAATCGTCAATA
AAAAATAA