SecReT6
Protein ID: 300725306
SecReT6 ID399
T6SS typei1
Gene symbolhcp
Locus tagXNC1_4554
StrainXenorhabdus nematophila ATCC 19061
Repliconchromosome [GenBank: NC_014228] [Browse all T6SS(s) in this replicon]
Location [Strand]4357739..4358257 [+]
Producthemolysin-coregulated protein Hcp
NoteTssD
UniProt IDD3VFB9
KEGG IDxne:XNC1_4554
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.70E-36, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|300725306|ref|YP_003714638.1| hcp gene product [Xenorhabdus nematophila ATCC 19061]
MPTPCYISINGKTQGNITAGAFTAESVGNIFVQGHEDEMLVQEFDHIVTVPTDPQSGQPSGQRAHKPFRF
TVALNKAVPLLYNALASGEMLPTVELKWYRTSIEGKQEHFFSTKLVDATIVDIDCKMPHCQDPAKSEFTQ
LVRVSLSYRKIEWEHTTAGTSGADDWRAPIVA
 
Nucleotide Sequence: 519 bp     [Download]
>gi|300721089|ref|NC_014228.1|:4357739-4358257 Xenorhabdus nematophila ATCC 19061 chromosome, complete genome
ATGCCAACTCCATGTTATATTTCCATCAATGGTAAAACTCAGGGCAATATTACCGCTGGCGCATTCACAG
CTGAATCCGTAGGTAATATCTTTGTTCAGGGCCACGAAGACGAAATGCTGGTTCAAGAATTTGACCACAT
TGTCACTGTTCCAACTGATCCACAGTCTGGACAGCCTTCTGGTCAGCGTGCCCATAAGCCATTCCGCTTT
ACCGTTGCTTTGAATAAAGCAGTTCCCCTGCTTTACAACGCACTGGCTTCCGGCGAAATGCTGCCTACTG
TAGAACTGAAGTGGTACCGTACTTCTATCGAAGGTAAACAAGAGCACTTCTTCTCGACTAAACTGGTAGA
TGCAACTATCGTTGATATCGACTGCAAAATGCCACACTGCCAGGACCCAGCAAAATCTGAGTTCACTCAG
TTAGTTCGTGTTTCTCTTTCTTATCGTAAGATTGAGTGGGAACACACCACGGCAGGTACTTCTGGTGCTG
ACGACTGGCGTGCGCCAATTGTTGCTTAA