SecReT6
Protein ID: 302037296
SecReT6 ID407
T6SS typei4a
Gene symbol-
Locus tagNIDE1969
StrainCandidatus Nitrospira defluvii
Repliconchromosome [GenBank: NC_014355] [Browse all T6SS(s) in this replicon]
Location [Strand]1878944..1880197 [+]
Producthypothetical protein
NoteFha
UniProt IDD8PEN4
KEGG IDnde:NIDE1969
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 5.70E-19, Aligned region: 28..96
Protein Sequence: 417 a.a.     [Download]
>gi|302037296|ref|YP_003797618.1| hypothetical protein NIDE1969 [Candidatus Nitrospira defluvii]
MAIRLEIHPPEILGCGQVRKHVFEQGDVTIGRASSNDVALEDPGRVVSSRHAEIRRRGEACVLVDVGSTN
GTSVNERPLVPQREYPLQEGDRILIGDFTILFSWQRPETNGTAHRVLEGSRSAIQSGDADALAYQLCRRY
AELSRGTTLEREAELSAMLRPILAGQDASACEALVGKIRAALCHRLGQPVTATPPEVSPEPPARTPPTAN
EAAYRGLLAIAQKYCMTVPTPMTPGFIGQFALRIDQVLHITFGNLLESLRGRRQFARELEVEATRILNWA
PNQLKQSESEQQVGAYLLDVLSNPKEAEVVMADLERVFRDLALHQIGLIKGFEESLRAVLREFDPAAIEA
DLARTPLQIGPLRLPPSFRLVKRWGAWAQFKRKHRRFTEEEVRIFEQILAPHFAKGYLDVQKTQRSL
 
Nucleotide Sequence: 1254 bp     [Download]
>ref|NC_014355.1|:1878944-1880197 hypothetical protein NIDE1969 [Candidatus Nitrospira defluvii]
ATGGCTATACGATTGGAAATTCACCCTCCCGAGATTCTCGGCTGCGGCCAGGTGCGGAAGCATGTCTTTG
AGCAAGGAGATGTGACCATCGGACGAGCATCCTCGAACGACGTGGCGTTGGAGGACCCGGGAAGGGTGGT
CTCTTCCCGTCACGCCGAGATCCGGCGGAGAGGTGAGGCTTGTGTACTGGTTGACGTCGGGAGTACTAAC
GGAACCAGCGTTAATGAGAGGCCGTTGGTCCCGCAGCGTGAGTATCCGCTACAGGAGGGAGACCGGATAC
TTATCGGTGATTTCACCATCCTATTTTCATGGCAGAGGCCAGAAACCAATGGCACCGCGCATCGTGTGCT
GGAGGGATCACGGTCGGCTATTCAAAGCGGAGATGCAGATGCCCTGGCATATCAATTGTGTCGTCGCTAC
GCAGAACTCAGTCGAGGTACCACGCTCGAACGGGAAGCGGAGTTATCAGCGATGTTGCGGCCGATTTTGG
CAGGACAGGATGCATCGGCCTGTGAGGCGCTGGTAGGAAAAATCCGCGCGGCGTTATGTCACCGATTGGG
TCAGCCGGTGACCGCGACTCCTCCGGAGGTGAGCCCTGAGCCACCAGCGCGTACGCCTCCAACTGCCAAC
GAGGCCGCGTACCGGGGGCTCCTGGCTATTGCGCAGAAGTACTGCATGACGGTTCCCACGCCGATGACCC
CTGGATTCATCGGTCAGTTCGCCCTGCGCATCGATCAAGTGCTCCATATTACCTTCGGCAACCTGCTGGA
ATCATTGCGAGGAAGGCGGCAGTTCGCCCGCGAATTGGAGGTGGAAGCAACCCGCATCCTCAATTGGGCG
CCAAATCAACTTAAGCAGTCGGAAAGCGAACAGCAGGTGGGAGCCTATCTTCTCGACGTGCTGTCCAATC
CTAAGGAAGCAGAAGTCGTGATGGCGGATCTCGAACGTGTCTTTCGCGATTTGGCTCTCCATCAAATCGG
GCTGATCAAGGGGTTCGAAGAAAGTCTTCGTGCCGTCCTACGAGAGTTCGATCCTGCGGCAATTGAAGCC
GACCTCGCACGCACTCCTCTACAAATCGGCCCCCTGCGACTTCCTCCGTCCTTTCGCCTCGTTAAGCGTT
GGGGCGCTTGGGCGCAGTTCAAACGGAAGCATCGTCGATTTACCGAGGAAGAGGTCAGGATCTTTGAGCA
AATACTGGCACCACATTTCGCGAAAGGGTATTTGGATGTTCAGAAGACGCAACGCAGTCTTTAA