SecReT6
Protein ID: 302037297
SecReT6 ID407
T6SS typei4a
Gene symbol-
Locus tagNIDE1970
StrainCandidatus Nitrospira defluvii
Repliconchromosome [GenBank: NC_014355] [Browse all T6SS(s) in this replicon]
Location [Strand]1880217..1880660 [+]
Producthypothetical protein
NoteTssJ
UniProt IDD8PEN5
KEGG IDnde:NIDE1970
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.30E-30, Aligned region: 9..141
Protein Sequence: 147 a.a.     [Download]
>gi|302037297|ref|YP_003797619.1| hypothetical protein NIDE1970 [Candidatus Nitrospira defluvii]
MLLMGGITVGCGSGVKDVRVTLLPTHRLNPDESGAPLSVIVRVYQLKNRERFERADFRALWKNDEKVLEG
DLLERQEVTVYPETKTSVELQVDQKKGVQFLGIMALFRKPEGELWRQVTSSDVSSWVPFRTPRVKFVLDE
HTIKLKD
 
Nucleotide Sequence: 444 bp     [Download]
>ref|NC_014355.1|:1880217-1880660 hypothetical protein NIDE1970 [Candidatus Nitrospira defluvii]
ATGCTCCTCATGGGGGGGATCACAGTCGGCTGCGGAAGCGGGGTGAAGGATGTCCGCGTGACCCTTCTGC
CGACCCACCGACTGAATCCAGATGAATCTGGTGCTCCCTTGTCCGTCATCGTGCGCGTCTATCAGTTGAA
AAATAGAGAGCGGTTTGAGCGGGCTGATTTTCGGGCGCTCTGGAAAAATGATGAGAAAGTCCTAGAGGGA
GACTTGCTCGAACGACAGGAGGTCACCGTCTACCCCGAGACCAAGACCTCTGTCGAATTGCAGGTGGATC
AGAAAAAGGGTGTGCAGTTCCTGGGAATCATGGCGTTGTTTCGCAAGCCGGAAGGGGAGTTGTGGCGACA
GGTCACGTCTTCGGACGTGTCCTCGTGGGTTCCGTTTCGGACTCCGAGAGTGAAATTTGTCCTGGATGAA
CACACGATCAAACTGAAGGACTAA