SecReT6
Protein ID: 302037298
SecReT6 ID407
T6SS typei4a
Gene symbol-
Locus tagNIDE1971
StrainCandidatus Nitrospira defluvii
Repliconchromosome [GenBank: NC_014355] [Browse all T6SS(s) in this replicon]
Location [Strand]1880685..1882025 [+]
Producthypothetical protein
NoteTssK
UniProt IDD8PEN6
KEGG IDnde:NIDE1971
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.90E-111, Aligned region: 20..443
Protein Sequence: 446 a.a.     [Download]
>gi|302037298|ref|YP_003797620.1| hypothetical protein NIDE1971 [Candidatus Nitrospira defluvii]
MENNQRVVWSEGMLLTPQLFQQWDQYYERHLNERFHALIAFGYGVLRLDFDHDGLSNGRVTLLGCHGVLP
DGLIVRIPEDDTAPQTRLIGDLFPASVDHLDVFLAVPVEQTEGVNCVLEGDSGSRAARYSSAYIERKDTT
TGGNPREILVAKKNLRIVFSGEPTTDMVVLKIGELLRTQAGAIALKETYIPSCLWISASPYLLRLLRGLI
ELLTAQIGSYGNAQRGILEAIGMDLGKYHLIASLVASLPALQHMSLVEKVHPEHLYLLLARLAGALTMLA
GPMETLELPPYHHDNLSATFEDLDHRIRAIVDRFQPTHYLTIPLEASGDNVWVGRVPESRLFASSQFFLV
AAGDLSEDQIRQQVPQFIRIGSPTKLKEIVAAAMPGVRLYHTPRPPATLPVRVGQQYFRLDDRGVFWEEI
KKSQIVALHVPQSLQSLRLQLLATKE
 
Nucleotide Sequence: 1341 bp     [Download]
>ref|NC_014355.1|:1880685-1882025 hypothetical protein NIDE1971 [Candidatus Nitrospira defluvii]
ATGGAGAACAACCAACGAGTCGTCTGGAGTGAGGGGATGCTGCTCACTCCCCAGTTGTTTCAACAGTGGG
ACCAATATTACGAGCGTCATCTGAATGAGCGTTTCCATGCGTTGATCGCCTTCGGCTACGGTGTGCTGCG
TCTGGACTTCGATCACGACGGTTTGTCGAACGGGCGAGTCACCTTGCTCGGCTGTCATGGGGTATTGCCG
GATGGACTCATCGTGAGGATTCCTGAAGATGATACGGCCCCGCAAACGCGTCTCATCGGCGATTTGTTCC
CGGCTTCGGTCGATCACCTGGATGTCTTTCTGGCAGTCCCGGTTGAACAGACGGAGGGCGTCAACTGTGT
GTTGGAGGGCGATTCGGGATCGCGAGCCGCCCGATATTCGTCGGCCTACATAGAACGGAAAGACACTACG
ACGGGCGGCAATCCGCGTGAGATCCTGGTCGCAAAAAAGAACCTCCGCATTGTGTTTTCCGGCGAACCAA
CAACCGACATGGTGGTCCTGAAGATCGGCGAGTTGCTTAGAACGCAGGCCGGCGCCATCGCTCTGAAGGA
AACCTATATCCCCTCGTGTTTATGGATTTCCGCTTCTCCGTATCTGCTGCGACTGCTCCGCGGCCTGATT
GAACTCTTGACTGCTCAAATCGGATCGTATGGAAATGCTCAGCGGGGGATATTGGAAGCTATCGGGATGG
ATTTAGGCAAATATCACCTCATCGCCTCGCTCGTGGCCAGTTTGCCGGCCCTGCAGCACATGAGTCTCGT
CGAAAAGGTGCATCCGGAACATCTCTACCTCCTTCTTGCCCGGCTGGCTGGAGCCCTCACGATGCTGGCG
GGTCCGATGGAGACGCTGGAGTTGCCCCCCTATCATCATGACAACCTGTCGGCCACGTTCGAGGATCTGG
ACCACCGTATTCGTGCCATCGTAGACCGCTTCCAGCCGACGCACTACCTGACCATCCCACTTGAGGCAAG
CGGGGACAATGTATGGGTCGGGCGAGTACCGGAAAGCCGCCTGTTCGCTTCGTCTCAATTCTTCTTAGTG
GCTGCGGGGGATCTCAGCGAGGATCAGATTCGCCAGCAGGTGCCGCAATTCATCAGGATCGGCTCGCCGA
CGAAGCTGAAAGAGATTGTGGCTGCCGCGATGCCGGGAGTCCGGCTGTACCATACGCCGCGGCCTCCGGC
GACATTGCCGGTTCGGGTAGGCCAGCAATACTTTCGCCTGGATGATCGAGGCGTGTTCTGGGAAGAGATC
AAGAAGTCGCAGATTGTTGCCTTGCATGTTCCCCAAAGCTTGCAATCGCTCCGGTTGCAGCTGCTGGCCA
CGAAGGAGTGA