SecReT6
Protein ID: 302037299
SecReT6 ID407
T6SS typei4a
Gene symbol-
Locus tagNIDE1972
StrainCandidatus Nitrospira defluvii
Repliconchromosome [GenBank: NC_014355] [Browse all T6SS(s) in this replicon]
Location [Strand]1882032..1882730 [+]
Producthypothetical protein
NoteTssL
UniProt IDD8PEN7
KEGG IDnde:NIDE1972
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.60E-53, Aligned region: 12..211
Protein Sequence: 232 a.a.     [Download]
>gi|302037299|ref|YP_003797621.1| hypothetical protein NIDE1972 [Candidatus Nitrospira defluvii]
MATVQVETTGSLSDVFNDLLVLGVQLRDATNPGSVESLRTRLHQLFQSAEENGRTAGLSQETLTQARYAV
AAFTDEMLINSRWPHKDEWAARPLQYEFFGEFVAGEGFFKRLEHIRGGVPVNADLLELYTYCLMLGFEGQ
YKLENRERLRGLVEDLTRQIQGKRGEIPPLSPRGRRPEELLEMVKRELPVWVIVVTSAALVLLFYAGLSF
LIGQDVGYVDHELKRLLQEVRG
 
Nucleotide Sequence: 699 bp     [Download]
>ref|NC_014355.1|:1882032-1882730 hypothetical protein NIDE1972 [Candidatus Nitrospira defluvii]
ATGGCTACCGTTCAAGTCGAGACGACGGGTTCTCTGAGCGACGTGTTCAACGATCTCCTGGTGCTGGGCG
TACAACTCCGTGATGCGACTAATCCAGGAAGCGTCGAGAGCCTGCGTACCCGGCTTCATCAATTGTTTCA
ATCGGCAGAGGAAAACGGGCGTACTGCCGGCTTGTCGCAAGAGACGTTGACCCAAGCGCGCTACGCTGTC
GCCGCGTTTACTGACGAGATGCTCATCAATTCGCGCTGGCCGCACAAGGACGAATGGGCAGCGCGGCCGC
TCCAATATGAATTTTTCGGCGAATTTGTAGCGGGAGAAGGGTTCTTTAAACGCCTGGAACATATTCGAGG
TGGAGTTCCGGTCAATGCCGATCTGCTCGAACTCTATACCTATTGTCTGATGCTCGGGTTCGAGGGACAG
TACAAACTGGAAAATCGTGAACGGCTGCGTGGTCTGGTTGAAGATCTGACACGCCAAATTCAGGGAAAGC
GCGGGGAGATCCCACCGCTTTCGCCGCGGGGACGGCGTCCGGAAGAGTTGCTTGAGATGGTCAAGCGTGA
ACTCCCCGTCTGGGTCATTGTGGTGACCAGCGCCGCCCTGGTTCTCTTGTTCTACGCGGGATTGTCTTTC
CTGATCGGACAAGATGTCGGCTATGTGGATCATGAATTGAAGCGCCTTTTGCAGGAGGTGCGAGGGTGA