SecReT6
Protein ID: 302037302
SecReT6 ID407
T6SS typei4a
Gene symbol-
Locus tagNIDE1975
StrainCandidatus Nitrospira defluvii
Repliconchromosome [GenBank: NC_014355] [Browse all T6SS(s) in this replicon]
Location [Strand]1887496..1888296 [+]
Producthypothetical protein
NoteTagJ
UniProt IDD8PEP0
KEGG IDnde:NIDE1975
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 6.90E-38, Aligned region: 138..260
TPR_19 [PF14559], Evalue: 0.001, Aligned region: 6..61
TPR_19 [PF14559], Evalue: 0.001, Aligned region: 112..134
Protein Sequence: 266 a.a.     [Download]
>gi|302037302|ref|YP_003797624.1| hypothetical protein NIDE1975 [Candidatus Nitrospira defluvii]
MGAKELLDQHHLSAAISELNQDIKRHPTDARLRTFLFELLCFAGDYDRGQRQLDVIGHQNEKVGIGVEVY
KNILRAEITRRRMFAEGIKPSFLFDPPEHVVLSMDAHNQLREHHVAEAKALYERAQGEQPEIRGRMKGHP
FTSFRDTDDRTAGILEVIVRDSYIWVPFERIRKVVIPQPKHLRDLLWVPASLEIEDGPVGDVFLPVLYAG
SELEADDQVRLGRLTEWVDLGAGLAGGVGQKTFLVDDREVSILEIGELEFEVLAAV
 
Nucleotide Sequence: 801 bp     [Download]
>ref|NC_014355.1|:1887496-1888296 hypothetical protein NIDE1975 [Candidatus Nitrospira defluvii]
ATGGGAGCGAAAGAGTTACTCGATCAACATCACCTTTCCGCCGCAATTAGCGAGCTCAATCAAGACATCA
AACGGCATCCGACGGACGCCCGACTACGAACATTTCTTTTTGAACTCCTGTGCTTCGCCGGCGACTATGA
TCGTGGACAACGTCAGCTTGACGTCATCGGACATCAAAATGAGAAAGTCGGCATCGGTGTGGAGGTCTAC
AAAAATATTCTCCGTGCGGAAATCACCCGGCGACGAATGTTTGCCGAGGGAATCAAGCCGAGTTTTCTGT
TTGATCCTCCTGAACATGTCGTGCTCTCTATGGACGCGCATAACCAGCTGCGCGAACACCATGTGGCCGA
AGCCAAGGCGCTGTATGAGCGAGCTCAAGGCGAACAGCCGGAAATACGCGGCAGGATGAAGGGCCATCCC
TTCACGTCTTTTCGCGACACCGACGACCGCACGGCGGGCATCCTGGAAGTGATCGTGCGCGACTCATACA
TCTGGGTGCCATTCGAACGGATTCGCAAAGTCGTCATCCCGCAACCAAAACATTTGCGAGATTTGTTGTG
GGTGCCGGCGTCGTTGGAAATAGAAGACGGACCGGTGGGTGACGTATTTCTTCCTGTGCTCTACGCCGGC
TCGGAGTTAGAGGCCGATGACCAGGTGCGTCTTGGCCGGCTTACCGAATGGGTTGATCTTGGCGCAGGAT
TGGCCGGAGGAGTCGGACAAAAAACGTTTCTCGTGGACGACCGTGAAGTATCGATTCTGGAGATTGGGGA
ATTGGAGTTCGAGGTGTTGGCGGCGGTGTGA