SecReT6
Protein ID: 302037303
SecReT6 ID407
T6SS typei4a
Gene symbol-
Locus tagNIDE1976
StrainCandidatus Nitrospira defluvii
Repliconchromosome [GenBank: NC_014355] [Browse all T6SS(s) in this replicon]
Location [Strand]1888312..1889430 [+]
Producthypothetical protein
NoteTssA
UniProt IDD8PEP1
KEGG IDnde:NIDE1976
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.40E-19, Aligned region: 58..117
Protein Sequence: 372 a.a.     [Download]
>gi|302037303|ref|YP_003797625.1| hypothetical protein NIDE1976 [Candidatus Nitrospira defluvii]
MASVPTVDIDAILKPISGDKPCGVDPRDGVSFDLLKEARREEDAASQGDWKREVKVADWPKVIQIATKVL
STEGKDLQVVAWLAEGLVKKHASAGLRDGLKVLRGLHEQYWDHFYPVIEDGDLEFRGGRLDALNKTLPIA
ILNMPLIHPPGGPAYSYWQYKESQEVENLRRGASTDGDKKRALAEALEEGKLEGEKFEKAVAMTPLTHCS
TILENLNQCWDEFEQFERIVDEKYRPEAPSLRFIKEAVSECRSLMNGIVRKKGGVGASTVIQPDNAPREA
DMAPVVQMTASGSGIMPVDRADALRRLGAVAEFFRRTEPHSPVAYLVQRAARWGEMPLEEWLQEVIKSDD
VLGNVRETLGLTQSRPTNEQTP
 
Nucleotide Sequence: 1119 bp     [Download]
>ref|NC_014355.1|:1888312-1889430 hypothetical protein NIDE1976 [Candidatus Nitrospira defluvii]
ATGGCTTCCGTACCGACAGTCGATATCGATGCGATTCTTAAACCGATTTCAGGCGACAAGCCCTGTGGAG
TCGATCCTCGCGATGGCGTGTCTTTTGATCTGCTGAAGGAAGCGCGACGGGAGGAAGATGCCGCGAGTCA
GGGGGATTGGAAGCGCGAGGTGAAGGTCGCTGATTGGCCGAAGGTTATCCAAATCGCAACAAAAGTTCTG
TCGACAGAGGGGAAGGATCTCCAGGTGGTTGCCTGGCTGGCGGAAGGATTGGTCAAAAAACACGCTTCGG
CGGGACTTCGGGATGGACTCAAGGTTCTACGCGGGTTGCACGAGCAGTACTGGGATCATTTTTACCCCGT
GATCGAAGACGGCGATCTGGAATTTCGCGGTGGACGACTCGACGCGCTGAACAAGACCTTGCCGATCGCC
ATCCTCAACATGCCTCTGATTCATCCACCCGGCGGGCCGGCGTACAGCTACTGGCAGTATAAAGAGTCCC
AAGAAGTTGAGAATCTCCGTCGCGGGGCTTCGACGGACGGAGATAAAAAGCGTGCGCTGGCCGAAGCGTT
GGAGGAAGGAAAACTCGAAGGTGAAAAATTCGAGAAAGCCGTGGCGATGACACCCCTGACCCATTGCTCG
ACAATTCTTGAGAACCTGAACCAATGTTGGGATGAATTCGAACAGTTCGAGCGAATCGTGGATGAAAAAT
ATCGCCCGGAGGCGCCAAGTTTGCGATTCATTAAGGAGGCCGTAAGCGAATGTCGGTCTCTGATGAATGG
AATTGTCCGAAAAAAGGGGGGCGTCGGGGCATCCACGGTAATTCAACCTGACAATGCTCCTCGGGAGGCC
GATATGGCACCGGTGGTACAGATGACGGCGAGCGGATCGGGCATTATGCCGGTAGACCGCGCGGATGCCT
TGCGGCGGCTAGGAGCCGTGGCTGAGTTTTTCCGTCGGACAGAACCGCATAGTCCTGTGGCCTATCTCGT
CCAGCGCGCAGCGCGGTGGGGGGAAATGCCCTTGGAAGAATGGCTGCAGGAGGTCATCAAGAGCGACGAT
GTGCTTGGCAACGTCCGTGAAACGCTGGGACTGACACAGAGCCGGCCGACGAATGAGCAAACTCCTTAG