SecReT6
Protein ID: 302037304
SecReT6 ID407
T6SS typei4a
Gene symbol-
Locus tagNIDE1977
StrainCandidatus Nitrospira defluvii
Repliconchromosome [GenBank: NC_014355] [Browse all T6SS(s) in this replicon]
Location [Strand]1889454..1889987 [+]
Producthypothetical protein
NoteTssB
UniProt IDD8PEP2
KEGG IDnde:NIDE1977
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.50E-55, Aligned region: 10..166
Protein Sequence: 177 a.a.     [Download]
>gi|302037304|ref|YP_003797626.1| hypothetical protein NIDE1977 [Candidatus Nitrospira defluvii]
MARESTQHKLDRVRPPRVQITYDVETGGAIEMKELPFVVGVMADLAGKPDQPPAPLKDPKRKFVETDRDN
FNDVMKGIGPRLAYKVDNKLTNDDTKIGVEIRFNNIDDFSPEQVAEQVEPLKKLVEVRKQLSALLAKTDG
NDKLAEKLQEIIGNTELQQKIGKEAGLGTEGGSRKEG
 
Nucleotide Sequence: 534 bp     [Download]
>ref|NC_014355.1|:1889454-1889987 hypothetical protein NIDE1977 [Candidatus Nitrospira defluvii]
ATGGCACGTGAAAGCACTCAACACAAGTTGGACCGGGTTCGGCCGCCGCGTGTGCAGATTACCTATGATG
TGGAGACGGGCGGCGCGATTGAGATGAAAGAGTTGCCGTTCGTAGTCGGTGTCATGGCGGACTTGGCCGG
GAAGCCGGATCAGCCCCCTGCGCCCTTGAAGGATCCCAAGCGCAAATTCGTGGAGACAGATAGGGATAAC
TTCAACGACGTGATGAAGGGGATCGGTCCGCGCCTCGCGTACAAGGTGGATAACAAGCTGACCAATGACG
ATACCAAGATCGGCGTGGAAATCCGTTTCAACAACATCGATGACTTCAGCCCCGAGCAGGTGGCCGAACA
GGTCGAGCCGCTGAAAAAGCTGGTGGAGGTCAGAAAACAGCTGTCCGCGCTTCTGGCGAAAACCGACGGG
AACGACAAGCTGGCTGAAAAACTGCAGGAAATCATCGGCAATACTGAGTTGCAGCAGAAGATCGGGAAAG
AAGCAGGACTGGGAACTGAGGGTGGTTCCCGGAAGGAGGGCTAA