SecReT6
Protein ID: 302037305
SecReT6 ID407
T6SS typei4a
Gene symbol-
Locus tagNIDE1978
StrainCandidatus Nitrospira defluvii
Repliconchromosome [GenBank: NC_014355] [Browse all T6SS(s) in this replicon]
Location [Strand]1889990..1891483 [+]
Producthypothetical protein
NoteTssC
UniProt IDD8PEP3
KEGG IDnde:NIDE1978
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.30E-199, Aligned region: 69..492
Protein Sequence: 497 a.a.     [Download]
>gi|302037305|ref|YP_003797627.1| hypothetical protein NIDE1978 [Candidatus Nitrospira defluvii]
MAEEAKQAQPQGAAVAGTEESGVLDQIINETRIGKDDWERDQSRRQISTLVEEVMKGTLRVSKDLEATIN
ARIADIDKVLSAQLNAIMHAPEFQKLEGAWRGLHYLVMQSETSTMLKIRVLNISKDELRKDLEKAVEFDQ
SALFKKVYEEEYGTFGGAPYGALIGDYEFGRHPQDLALLEKVSNVAAAAHAPFISAAAPGLLGLEDFTDL
PNPRDLAKKFETPDYAKWKSFRESEDSRYVGLTLPHVLMRLPYGPDTVPVENFNFKEDVDGTDHSKYLWG
NAAYAMGARLTDAFAKYGWTAAIRGVEGGGRVDGLPTHTFRTDEGEIALKCPTEIAITDRREKELSDLGF
IPLVHCKGTDFAAFFGAQSCQKAKKYDTDAANANARLSTQLQYLLAMSRFAHYLKSIMRDKIGSFMTRKD
CEDFLNRWISKYVVSTEDAGQEIKAKFPLKEARVEVAEVAGKPGVYRAIAFLKPHFQLDELTVSLRLVAE
LPPPAKR
 
Nucleotide Sequence: 1494 bp     [Download]
>ref|NC_014355.1|:1889990-1891483 hypothetical protein NIDE1978 [Candidatus Nitrospira defluvii]
ATGGCGGAAGAGGCGAAACAAGCGCAGCCTCAGGGGGCGGCGGTCGCGGGAACCGAGGAGAGCGGGGTTC
TTGATCAGATTATCAATGAAACACGCATCGGAAAAGACGACTGGGAGCGTGACCAGTCGCGCCGGCAGAT
TTCCACCCTTGTTGAGGAGGTGATGAAAGGCACCCTCCGAGTGTCGAAAGACCTCGAGGCGACGATCAAT
GCACGCATCGCGGACATCGACAAGGTTTTATCCGCCCAGCTCAACGCGATCATGCATGCACCGGAGTTTC
AAAAGCTGGAAGGGGCCTGGCGCGGGCTGCACTATCTCGTCATGCAAAGCGAAACCAGCACCATGCTGAA
AATTCGTGTGCTGAATATCAGCAAGGACGAACTACGGAAGGATCTTGAGAAGGCCGTCGAATTCGACCAA
AGCGCACTCTTCAAGAAAGTGTATGAGGAAGAGTACGGGACCTTCGGTGGAGCGCCCTATGGCGCCTTGA
TTGGAGATTATGAGTTCGGACGGCATCCTCAGGATTTGGCATTGCTGGAGAAGGTCTCGAATGTGGCAGC
TGCGGCACATGCGCCGTTCATCTCAGCGGCTGCCCCGGGCCTGCTGGGGCTTGAAGATTTTACAGATCTT
CCGAATCCTCGTGATCTGGCCAAGAAGTTCGAAACGCCGGATTACGCCAAATGGAAGTCGTTTCGTGAAT
CAGAGGACTCTCGCTATGTGGGGCTCACCTTGCCCCATGTGTTGATGCGGCTGCCGTACGGGCCGGATAC
GGTGCCGGTCGAGAACTTTAATTTCAAAGAAGACGTCGATGGCACGGACCACAGCAAGTATCTCTGGGGG
AATGCCGCCTATGCGATGGGGGCTCGTCTCACGGATGCCTTTGCAAAGTATGGCTGGACCGCGGCCATTC
GTGGCGTGGAGGGGGGAGGACGTGTGGATGGGTTGCCGACCCATACGTTCCGTACCGATGAAGGTGAGAT
TGCGCTGAAGTGTCCGACCGAGATTGCCATCACCGACCGGCGTGAGAAGGAGCTGTCGGATCTCGGATTT
ATTCCGCTCGTCCATTGCAAGGGGACAGACTTTGCCGCCTTCTTCGGGGCCCAATCCTGCCAGAAAGCCA
AGAAATATGACACGGACGCCGCCAACGCTAATGCGCGGCTCTCAACTCAGCTCCAATATCTCCTGGCGAT
GTCACGCTTCGCGCATTATCTCAAGTCGATCATGCGGGACAAAATCGGAAGCTTCATGACACGCAAAGAT
TGTGAGGATTTCCTGAATCGCTGGATCAGCAAGTATGTCGTAAGCACGGAAGATGCCGGGCAGGAGATCA
AAGCCAAGTTTCCCTTGAAGGAGGCCCGAGTGGAGGTGGCAGAGGTGGCAGGAAAGCCCGGTGTCTATAG
AGCCATTGCTTTCTTGAAGCCTCACTTCCAGTTGGATGAGCTGACAGTGTCGCTCAGGTTAGTGGCTGAG
CTGCCGCCGCCGGCCAAGCGGTAG