SecReT6
Protein ID: 302037309
SecReT6 ID407
T6SS typei4a
Gene symbol-
Locus tagNIDE1982
StrainCandidatus Nitrospira defluvii
Repliconchromosome [GenBank: NC_014355] [Browse all T6SS(s) in this replicon]
Location [Strand]1893973..1894809 [+]
Producthypothetical protein
NoteTssE
UniProt IDD8PEP7
KEGG IDnde:NIDE1982
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 8.20E-22, Aligned region: 153..259
Protein Sequence: 278 a.a.     [Download]
>gi|302037309|ref|YP_003797631.1| hypothetical protein NIDE1982 [Candidatus Nitrospira defluvii]
MAVTANDRNLNASLLDRLLDDDPRAGDPYLDTLDLKDPAKLTLRLRRPQDSVTRFLRDQLGQEERGFVDR
EGPVANDLLLALTEGLNRIIRGPLLYERKRFEGVKLSPDTVRLMEDSRKTSRVALLNRMLLDEIFSDELH
KMRKPAPSSANIRELKKSISRDIEALLNTRREFLDGTPPEYKEVNNSLLMFGLPDFTSYSLLNPEHRKLI
RRSVEEALTKFEPRLKSVQVSLESPRKFDAALHFRIDALLRLDPAPEPVTFDAALQLGTSSYSVRGEG
 
Nucleotide Sequence: 837 bp     [Download]
>ref|NC_014355.1|:1893973-1894809 hypothetical protein NIDE1982 [Candidatus Nitrospira defluvii]
TTGGCCGTGACGGCGAATGATCGAAATCTGAACGCTTCGCTTCTCGACCGCCTGCTGGATGACGATCCTC
GGGCAGGCGATCCTTATCTGGACACCCTGGACCTCAAGGATCCGGCGAAGCTGACGCTACGTTTGCGGAG
GCCGCAGGACTCCGTCACGCGGTTCTTGCGGGACCAGCTTGGTCAGGAGGAGCGAGGGTTCGTGGATCGG
GAGGGGCCTGTCGCAAATGACCTCCTGCTCGCCCTCACCGAAGGCCTCAACCGTATCATCCGAGGGCCCC
TGCTGTACGAACGAAAGAGGTTCGAAGGCGTCAAACTCTCCCCGGATACAGTGCGTCTCATGGAAGATAG
CCGGAAAACATCTCGTGTGGCGCTGCTGAATCGTATGTTGCTGGATGAGATTTTTTCCGACGAACTACAC
AAGATGCGGAAGCCCGCCCCCTCTTCAGCGAACATCCGCGAGCTGAAGAAATCGATTTCCCGGGATATCG
AGGCCTTGCTGAATACCAGGCGCGAATTTCTGGACGGCACCCCCCCTGAGTACAAAGAAGTCAATAATTC
GCTCTTGATGTTCGGCTTGCCGGATTTCACCAGCTACAGCCTGTTGAACCCTGAACACCGGAAGTTGATC
CGTCGATCCGTCGAGGAGGCCTTGACCAAGTTCGAGCCTCGGCTGAAATCGGTACAGGTGTCGCTGGAAT
CGCCGCGCAAATTTGATGCAGCGCTTCATTTCCGTATCGATGCGCTGCTGCGTCTTGATCCGGCGCCGGA
ACCGGTTACCTTCGACGCAGCCCTACAGCTAGGGACGTCGTCCTACAGCGTGCGAGGAGAAGGCTAG