SecReT6
Protein ID: 302037310
SecReT6 ID407
T6SS typei4a
Gene symbol-
Locus tagNIDE1983
StrainCandidatus Nitrospira defluvii
Repliconchromosome [GenBank: NC_014355] [Browse all T6SS(s) in this replicon]
Location [Strand]1894809..1896623 [+]
Producthypothetical protein
NoteTssF
UniProt IDD8PEP8
KEGG IDnde:NIDE1983
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.40E-217, Aligned region: 5..604
Protein Sequence: 604 a.a.     [Download]
>gi|302037310|ref|YP_003797632.1| hypothetical protein NIDE1983 [Candidatus Nitrospira defluvii]
MQETLLEYYERELSAIRQLGQEFAQAYPKVAGRLLLEPNKCEDPHVERLIQAFAFLAARVHLKIDEEFPQ
VTDALLGMLYPHYLAPIPSMSVVEFVPDPEQGKLTSGYVMPAGTQLYSRPIDGTQCRFRTCYATTLWPIT
LASVKVQPSDRALPGGKPGTALKLELHSLGGLTFKDLQVDALRFYLNGEAPLAYALYELLLNHTYEVRCR
AAGAKPGEKPVVLPPGCLRPVGFEKDEGLLPYPPQALLGYRLLHEYFTFPQKFLFVELSGLQRAVKVGVG
NKLEVELILDQAPRSDYMPTVETFRLGCAPVVNLFSHTAEPIRLDQTQHEYRVIPEVRRPLASEIYSIDA
VSLMSGETQTVRPVQPIYSLKHTRTDRDQSAFWYQTRRPSDRKGDAGTEVYVSLVDLALNPTVPAGDTLM
LSTTCTNRGLTGRLPMDDPRGDFELEKAAPVARIRALVKPTQPIQPPLGGDRQWRFISHLSLNYLSLTEG
GPHALQEILRLYDFSDSSVVHQQIDGITKVSSRRVTRRPTSMGWSGFCRGMEVTLEFNESKYVGSSVYLF
ASVLEKFFALYASLNSFTQFVARTEQRERPLKQWPPRAGEQILI
 
Nucleotide Sequence: 1815 bp     [Download]
>ref|NC_014355.1|:1894809-1896623 hypothetical protein NIDE1983 [Candidatus Nitrospira defluvii]
GTGCAAGAGACATTGCTCGAATATTACGAGCGCGAACTTTCGGCCATCCGGCAATTGGGGCAAGAATTCG
CTCAGGCGTATCCCAAGGTGGCGGGCCGGCTCCTGCTTGAACCCAACAAATGCGAAGATCCGCACGTTGA
GCGTCTGATCCAGGCCTTTGCATTCCTCGCTGCGCGAGTTCATCTCAAGATCGACGAAGAGTTCCCCCAG
GTGACCGATGCGCTACTCGGAATGTTATATCCGCATTACCTGGCCCCCATTCCCTCCATGTCAGTCGTCG
AATTCGTTCCGGACCCTGAACAGGGAAAACTGACGAGTGGGTATGTCATGCCGGCGGGCACGCAGTTATA
TTCCCGCCCCATCGATGGCACCCAATGCCGGTTCCGGACATGCTACGCCACAACCCTTTGGCCGATCACG
CTGGCCTCCGTCAAAGTGCAACCGTCCGACCGTGCCCTACCTGGAGGAAAGCCCGGAACGGCCCTCAAAT
TGGAACTCCATTCGCTGGGCGGTCTCACGTTTAAGGACTTGCAAGTCGACGCACTACGCTTCTATCTGAA
CGGCGAGGCTCCGCTGGCCTACGCCCTCTATGAATTGCTGCTCAATCATACGTATGAAGTCCGTTGTCGG
GCGGCCGGGGCGAAGCCTGGCGAAAAGCCGGTCGTGTTACCGCCGGGTTGCTTGCGTCCGGTCGGCTTCG
AGAAGGACGAAGGGTTGCTGCCATATCCTCCGCAGGCCTTGCTGGGTTACCGACTCTTACACGAGTACTT
TACCTTCCCGCAGAAATTTCTGTTCGTGGAATTGAGTGGATTGCAGCGAGCGGTCAAGGTGGGCGTGGGA
AACAAGCTGGAAGTAGAGCTCATCCTGGATCAGGCGCCGCGGTCGGATTACATGCCGACGGTGGAGACGT
TTCGCCTCGGCTGTGCGCCGGTAGTGAATTTGTTCTCGCACACGGCTGAACCGATTCGATTAGATCAGAC
ACAGCACGAATATCGAGTCATTCCCGAAGTCAGGCGCCCGCTGGCGAGCGAAATTTATTCCATTGATGCC
GTGTCTCTCATGTCCGGTGAGACGCAAACCGTGAGGCCCGTACAGCCGATCTATTCGTTGAAACATACCC
GCACTGATCGCGACCAGAGCGCGTTCTGGTATCAAACCCGCAGGCCGTCGGATCGAAAGGGCGACGCCGG
TACCGAAGTGTATGTGTCACTCGTGGATCTCGCCTTGAACCCGACTGTGCCCGCCGGCGATACGCTCATG
CTGTCTACGACCTGCACCAATAGGGGCCTCACCGGTCGGCTGCCTATGGACGATCCCAGAGGCGATTTTG
AACTGGAGAAGGCTGCGCCGGTGGCGCGTATACGAGCGCTGGTGAAACCAACGCAGCCGATCCAGCCGCC
ACTAGGAGGCGATCGACAATGGAGATTCATTTCCCATCTCTCGTTGAACTACCTCTCGTTGACCGAGGGC
GGTCCCCATGCCTTACAAGAAATCCTGCGGCTGTACGACTTTTCTGATTCCAGCGTCGTGCACCAGCAAA
TCGATGGAATTACCAAAGTCTCCTCCCGCCGGGTGACGCGTCGGCCGACGTCGATGGGGTGGAGCGGGTT
CTGTCGCGGGATGGAAGTCACCCTTGAGTTCAACGAAAGCAAGTACGTGGGGAGCAGCGTCTATCTCTTT
GCCAGCGTGCTGGAGAAGTTTTTTGCGCTCTATGCGTCCCTTAATTCATTCACCCAGTTCGTCGCCCGTA
CGGAACAGCGAGAAAGGCCGCTCAAGCAATGGCCGCCCAGAGCCGGGGAGCAGATTCTGATCTAA