SecReT6
Protein ID: 302037312
SecReT6 ID407
T6SS typei4a
Gene symbolclpV1
Locus tagNIDE1985
StrainCandidatus Nitrospira defluvii
Repliconchromosome [GenBank: NC_014355] [Browse all T6SS(s) in this replicon]
Location [Strand]1897676..1900405 [+]
Producttype VI secretion AtPase, ClpV1 family
NoteTssH
UniProt IDD8PEQ0
KEGG IDnde:NIDE1985
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.20E-41, Aligned region: 227..244
AAA_2 [PF07724], Evalue: 3.20E-41, Aligned region: 640..806
AAA [PF00004], Evalue: 3.60E-17, Aligned region: 227..359
AAA [PF00004], Evalue: 3.60E-17, Aligned region: 646..764
ClpB_D2-small [PF10431], Evalue: 1.00E-13, Aligned region: 815..887
AAA_5 [PF07728], Evalue: 8.80E-12, Aligned region: 227..247
AAA_5 [PF07728], Evalue: 8.80E-12, Aligned region: 301..357
AAA_5 [PF07728], Evalue: 8.80E-12, Aligned region: 645..765
AAA_16 [PF13191], Evalue: 9.20E-11, Aligned region: 204..244
AAA_16 [PF13191], Evalue: 9.20E-11, Aligned region: 270..305
AAA_16 [PF13191], Evalue: 9.20E-11, Aligned region: 445..473
AAA_16 [PF13191], Evalue: 9.20E-11, Aligned region: 614..658
AAA_16 [PF13191], Evalue: 9.20E-11, Aligned region: 710..738
AAA_22 [PF13401], Evalue: 8.10E-07, Aligned region: 226..308
AAA_22 [PF13401], Evalue: 8.10E-07, Aligned region: 343..399
AAA_22 [PF13401], Evalue: 8.10E-07, Aligned region: 643..664
AAA_22 [PF13401], Evalue: 8.10E-07, Aligned region: 707..726
Sigma54_activat [PF00158], Evalue: 8.00E-05, Aligned region: 210..241
Sigma54_activat [PF00158], Evalue: 8.00E-05, Aligned region: 644..763
AAA_18 [PF13238], Evalue: 0.00048, Aligned region: 227..247
AAA_18 [PF13238], Evalue: 0.00048, Aligned region: 647..675
Arch_ATPase [PF01637], Evalue: 0.00049, Aligned region: 206..240
Arch_ATPase [PF01637], Evalue: 0.00049, Aligned region: 280..382
Arch_ATPase [PF01637], Evalue: 0.00049, Aligned region: 647..657
IstB_IS21 [PF01695], Evalue: 0.00061, Aligned region: 221..249
IstB_IS21 [PF01695], Evalue: 0.00061, Aligned region: 645..664
IstB_IS21 [PF01695], Evalue: 0.00061, Aligned region: 755..777
IstB_IS21 [PF01695], Evalue: 0.00061, Aligned region: 840..855
AAA_25 [PF13481], Evalue: 0.00079, Aligned region: 226..252
AAA_25 [PF13481], Evalue: 0.00079, Aligned region: 438..473
AAA_25 [PF13481], Evalue: 0.00079, Aligned region: 641..663
AAA_25 [PF13481], Evalue: 0.00079, Aligned region: 708..729
AAA_17 [PF13207], Evalue: 0.0017, Aligned region: 227..247
AAA_17 [PF13207], Evalue: 0.0017, Aligned region: 645..683
AAA_29 [PF13555], Evalue: 0.0023, Aligned region: 220..243
AAA_29 [PF13555], Evalue: 0.0023, Aligned region: 643..670
AAA_19 [PF13245], Evalue: 0.0054, Aligned region: 226..249
AAA_19 [PF13245], Evalue: 0.0054, Aligned region: 646..667
Protein Sequence: 909 a.a.     [Download]
>gi|302037312|ref|YP_003797634.1| type VI secretion AtPase, ClpV1 family [Candidatus Nitrospira defluvii]
MNINLKGLIGKLDDTCRRALEGAAGLCLSRTHYDVDIEHLLSKLLEMSNTDIHKICHHYEIDHSRFARDL
TRSLDRFKTGNARTPTLAPQVPRLINEAWSLASIEYGVNRVRSGHLMLALLVEADFARMMRELSPETQKI
SAEDLHRRLGEIVSGSAEDLEDVQTGGVEQPTTQGAPHASRTPALDQFTIDLTARAKQGQIDPVLGRDAE
IRQVVDILTRRRQNNPILTGEAGVGKTAVVEGLALRIVTGDVPPPLQNVTLRVLDLALLQAGAGVKGEFE
NRLKSVINEVKASPKPIITFIDEAHTLIGAGGAAGQGDAANILKPALARGELRTIAATTWAEYKKYFEKD
PALTRRFQVVKVEEPTESVAINMMRGLAGTLEEHHKVRLLDEAIEAAVRLSHRYISGRQLPDKAVSVLDT
ACARVALGQVAEPPALEDARRRISLINTEVDILEREAITGGSHQERLAELGREKVAEEQRLAELRTRWEQ
EKKVVGEIAGIRKKLEQHAVPPKAPDKPTDKVPDKATKAPPDKAIETPPAKLTPQEIETLQTDLARLNKE
LTVLQGETPLLQPCVDGQAIAQVISAWTGIPIGRMVKDEINTVLTLKEHLEKRVVGQSHALDALSQRLRT
ARAKLEDPRRPIGVFMFVGPSGVGKTETGLALAELLFGSDQNITTLNMSEFKEEHKVSLLMGSPPGYVGY
GEGGVLTEAVRRKPYSVILLDEMEKAHPGVQDIFYQVFDKGMMKDGEGRDIDFKNTVIIMTSNAGTDTFM
KLCADPETRPDPEALADAIRPDLLKYFKPAFLGRLIVVPYYPISPDIMRRIIELQLSRVRSRIKENHRAV
MSYDEALITAIADRCTEVESGARNVDHILTRTLLPELSTEFLSRMAAGELVNKVHISVEPGGNFRYEVA
 
Nucleotide Sequence: 2730 bp     [Download]
>ref|NC_014355.1|:1897676-1900405 type VI secretion AtPase, ClpV1 family [Candidatus Nitrospira defluvii]
ATGAATATCAATTTGAAAGGACTCATCGGCAAGCTCGATGACACCTGTCGTCGCGCGTTGGAGGGCGCGG
CAGGGTTGTGTCTGAGCCGGACCCATTATGACGTGGATATCGAGCATCTCCTCAGTAAATTGCTCGAAAT
GTCGAATACGGATATCCACAAGATTTGTCACCACTACGAGATCGATCATTCGCGGTTCGCTCGAGACCTC
ACACGATCACTCGACCGCTTCAAGACCGGCAATGCGAGGACGCCGACCCTGGCGCCTCAGGTCCCGCGCC
TCATCAATGAAGCCTGGTCATTGGCCTCCATTGAGTACGGAGTGAATCGTGTGCGGTCCGGCCACCTAAT
GCTGGCCTTGCTCGTCGAAGCCGATTTTGCCCGCATGATGCGCGAGCTGTCGCCCGAGACGCAGAAGATC
TCAGCCGAAGATCTACACCGACGGTTGGGGGAGATCGTCTCGGGTTCAGCGGAGGATCTGGAAGATGTTC
AGACGGGAGGCGTCGAGCAGCCGACGACGCAGGGGGCTCCTCATGCTTCCAGGACCCCGGCCCTTGATCA
ATTCACCATCGATCTGACAGCGAGGGCCAAACAAGGGCAGATCGATCCGGTGCTGGGGCGGGATGCCGAG
ATCCGGCAGGTCGTGGATATCTTGACGCGCCGCCGGCAGAACAATCCCATTCTGACCGGAGAGGCCGGAG
TGGGAAAAACCGCCGTCGTGGAAGGATTGGCGCTCAGAATCGTCACGGGCGATGTCCCCCCGCCGTTACA
AAACGTCACCCTGCGGGTGCTCGACCTTGCGTTGCTCCAGGCCGGAGCGGGAGTAAAGGGGGAATTCGAA
AATCGCCTCAAGTCGGTCATTAACGAAGTCAAAGCCTCCCCGAAACCTATTATTACCTTTATCGATGAGG
CGCACACCTTGATCGGGGCGGGCGGAGCAGCGGGCCAGGGCGATGCCGCCAACATTCTCAAGCCGGCGCT
GGCTCGGGGAGAGTTGCGGACGATTGCCGCCACCACCTGGGCCGAATACAAGAAATATTTCGAGAAAGAT
CCGGCACTCACCAGACGGTTTCAGGTGGTGAAGGTGGAAGAGCCGACCGAATCCGTCGCGATCAACATGA
TGCGAGGATTAGCCGGGACGCTGGAAGAACATCACAAGGTGCGGTTGTTGGATGAGGCGATCGAGGCTGC
GGTGAGACTGTCCCATCGATATATTTCCGGCCGGCAACTGCCGGACAAAGCCGTCAGCGTGCTGGACACC
GCCTGTGCCCGAGTGGCCCTGGGACAGGTCGCAGAGCCGCCGGCGCTGGAAGACGCGCGCCGGCGAATCT
CCCTCATCAATACCGAGGTCGACATTCTGGAGCGGGAGGCCATCACGGGTGGAAGTCATCAGGAGCGTCT
GGCCGAATTGGGCAGGGAGAAAGTCGCAGAAGAACAGCGTCTGGCCGAGCTCAGGACCAGGTGGGAGCAG
GAAAAAAAGGTGGTTGGAGAGATCGCAGGGATCCGGAAAAAGTTGGAACAGCATGCCGTGCCACCAAAGG
CTCCGGACAAGCCAACCGACAAGGTTCCGGACAAGGCAACCAAAGCGCCTCCCGACAAGGCGATTGAAAC
GCCGCCCGCCAAGCTGACCCCTCAGGAAATCGAGACGTTGCAAACAGACTTGGCGAGGCTGAATAAAGAA
CTGACCGTTCTCCAGGGAGAGACCCCGCTCCTGCAGCCCTGTGTGGACGGGCAGGCCATCGCTCAGGTGA
TCTCGGCCTGGACCGGCATTCCTATCGGACGGATGGTCAAAGACGAGATCAATACCGTGTTGACGCTCAA
GGAGCATTTAGAAAAACGTGTGGTAGGACAATCGCATGCCCTGGATGCGCTGAGCCAACGCCTGCGAACG
GCACGGGCAAAATTGGAGGATCCTCGCCGGCCGATCGGGGTGTTCATGTTTGTCGGACCAAGCGGGGTGG
GGAAGACGGAAACGGGTCTGGCGCTCGCCGAGTTGCTGTTCGGCAGCGATCAAAACATCACCACCCTGAA
TATGTCCGAGTTCAAGGAAGAGCACAAAGTTTCGCTGTTGATGGGCTCACCTCCGGGCTATGTGGGCTAT
GGCGAGGGAGGGGTCTTGACGGAAGCGGTACGCCGAAAACCGTATAGCGTGATCCTGCTGGACGAGATGG
AAAAAGCCCATCCGGGTGTGCAGGACATTTTCTATCAGGTGTTCGACAAGGGCATGATGAAAGATGGCGA
GGGGCGGGATATCGATTTCAAAAACACCGTGATCATCATGACCTCCAACGCGGGGACGGATACGTTCATG
AAGCTCTGTGCCGATCCGGAGACCAGGCCTGATCCAGAGGCCCTAGCCGATGCGATTCGCCCTGATCTCT
TGAAATACTTCAAGCCGGCCTTTCTGGGACGACTCATCGTGGTGCCATACTATCCGATTTCTCCCGATAT
CATGCGGCGCATCATCGAATTGCAGCTCAGCCGGGTCCGCAGCCGCATCAAGGAGAACCACCGTGCGGTG
ATGTCTTACGACGAAGCCCTGATCACGGCGATTGCGGACCGCTGCACCGAAGTGGAGAGCGGCGCGCGGA
ACGTGGATCACATTCTGACGCGGACGTTGTTGCCGGAACTCTCGACGGAATTTCTTTCACGGATGGCAGC
AGGGGAATTGGTCAACAAGGTCCATATCTCGGTCGAGCCTGGCGGGAACTTCCGTTACGAGGTGGCGTGA