SecReT6
Protein ID: 302037336
SecReT6 ID407
T6SS typei4a
Gene symbol-
Locus tagNIDE2011
StrainCandidatus Nitrospira defluvii
Repliconchromosome [GenBank: NC_014355] [Browse all T6SS(s) in this replicon]
Location [Strand]1922707..1924278 [-]
Producthypothetical protein
NoteTssC
UniProt IDD8PES4
KEGG IDnde:NIDE2011
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.70E-76, Aligned region: 211..511
DUF770 [PF05591], Evalue: 8.10E-12, Aligned region: 28..123
Protein Sequence: 523 a.a.     [Download]
>gi|302037336|ref|YP_003797658.1| hypothetical protein NIDE2011 [Candidatus Nitrospira defluvii]
MTTPRATSSVDVILTAGEPRPVGRPAQDVPFRMLIMGNFSGRDSPLDRTAQRPPAAWHPMRVDRDNLQTI
PDKLHVAIHSPLLGESAPSITLKFASLDDWHPDRLLHQIEPLRRLSDLRRRLTSPDTFSAAAAEVRGWTQ
PGQPKKARSVAVDTSPHQAALSGSPTSGLLDHILEQTPTAMRDLGPTEWQSYLQALIKPHLVPKEHPLTH
ELVAQVDEAMSQILRTVLHHPTFQELRTAWLGLSFLVDRLETDSPLQLYLLDVSKDELSADLLSGDDLYA
TRLYRLLVQETVRTPGAHPWAVVGGVYTFDRTSEDVQLLERIAHLAKEAGAPFLAAASPGMMGCSSFGAT
PDPDDWQNPAAHPEEQQQWERLRRVDQASYLGLSLPRFLLRLPFGRETEAISAFEFEEMAGIPDHDNYCW
GNPIFAGLALLGQAFSEEGWQLRPGSVQDIDGLPLYVYQDETGGTVTKPCAEAWLTEQAAERLLEAGLMP
LLSYKDQDRIRLVRFQSIASPLKPLEGRWSEAG
 
Nucleotide Sequence: 1572 bp     [Download]
>ref|NC_014355.1|:c1924278-1922707 hypothetical protein NIDE2011 [Candidatus Nitrospira defluvii]
ATGACAACTCCACGCGCCACCAGCAGCGTTGATGTCATCCTCACAGCTGGAGAGCCCCGCCCCGTTGGAC
GACCGGCTCAAGACGTTCCATTTCGCATGTTGATCATGGGAAATTTCAGCGGAAGGGACAGCCCGCTTGA
TCGCACTGCACAACGGCCGCCGGCGGCCTGGCACCCGATGCGAGTAGATCGGGACAACCTCCAGACCATT
CCGGACAAGCTTCACGTCGCGATTCACAGTCCCCTCCTTGGAGAAAGTGCTCCTTCCATCACGCTTAAAT
TCGCCAGCCTTGATGACTGGCATCCCGATCGTCTGCTCCATCAGATTGAACCCCTGCGAAGGCTCTCCGA
CCTGCGCCGGCGCCTGACGAGCCCGGACACATTCTCTGCGGCGGCCGCCGAGGTCCGCGGATGGACGCAA
CCCGGACAACCAAAGAAAGCCCGATCAGTTGCCGTCGACACTTCACCCCACCAGGCAGCCCTCAGCGGCT
CACCAACCAGCGGTCTCCTGGACCACATACTCGAACAAACTCCCACAGCCATGCGCGATCTTGGCCCTAC
CGAATGGCAATCGTATCTTCAAGCGCTGATCAAGCCACACCTGGTCCCGAAAGAACATCCGCTGACACAC
GAACTGGTCGCGCAGGTTGATGAAGCCATGAGTCAGATCCTGAGAACCGTGCTCCACCATCCAACATTCC
AAGAACTGAGAACGGCCTGGCTGGGGCTCTCATTCCTCGTGGATCGGCTTGAAACCGATTCGCCGCTTCA
GCTCTACCTGCTGGATGTCTCCAAGGATGAACTATCAGCAGACTTGCTCAGCGGCGACGATCTGTATGCG
ACCCGGCTCTACCGCCTCTTGGTCCAAGAGACGGTCCGCACTCCCGGCGCGCATCCGTGGGCTGTGGTCG
GTGGAGTCTATACGTTCGATCGGACGAGTGAAGACGTGCAGCTACTGGAGCGGATTGCCCACCTTGCCAA
GGAAGCCGGGGCGCCGTTTCTGGCTGCCGCCTCACCCGGCATGATGGGCTGTTCTTCGTTTGGGGCAACG
CCGGATCCGGATGACTGGCAAAACCCGGCGGCACATCCGGAGGAACAGCAACAATGGGAACGGCTGCGAC
GGGTGGATCAAGCGTCGTATCTCGGGCTCTCTCTGCCGCGGTTCTTACTCCGCCTGCCGTTCGGACGGGA
GACAGAAGCGATCAGCGCCTTTGAGTTTGAGGAAATGGCGGGCATCCCCGACCACGACAACTATTGCTGG
GGCAACCCGATATTCGCCGGTCTTGCGCTCCTGGGGCAGGCGTTCTCGGAAGAGGGCTGGCAGCTCCGCC
CTGGATCAGTCCAAGACATTGACGGGCTCCCGTTATATGTCTATCAGGATGAGACGGGGGGCACCGTGAC
CAAACCCTGTGCCGAAGCCTGGCTCACGGAACAGGCAGCCGAGCGACTACTTGAAGCAGGCCTGATGCCG
CTCCTCTCCTACAAAGACCAGGATCGCATCCGCCTGGTGCGGTTCCAGTCGATCGCATCGCCATTAAAAC
CGTTGGAAGGCCGGTGGAGTGAAGCAGGATAG