SecReT6
Protein ID: 304310844
SecReT6 ID408
T6SS typei1
Gene symbol-
Locus tagHDN1F_12060
StrainGamma proteobacterium HdN1
Repliconchromosome [GenBank: NC_014366] [Browse all T6SS(s) in this replicon]
Location [Strand]1492541..1493746 [-]
Producthypothetical protein
NoteTssG
UniProt IDE1VIZ7
KEGG IDgpb:HDN1F_12060
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.30E-54, Aligned region: 21..383
Protein Sequence: 401 a.a.     [Download]
>gi|304310844|ref|YP_003810442.1| unnamed protein product [gamma proteobacterium HdN1]
MNTPEKSLTPALEAALLQRGDTFSYLQAYRLLAQALSEQGNNPETALRLRPALSLALPRAAIQQISTYSA
ESSVHKSSVEQSSAEERSVEERSAENARETPSENKSDEYSQSQAHNPKTSRYEIQANFLGLYGASSPLPN
FYTEDLITGEQEDQLQARQLLDIFHQRAYHLYAAALQKYRPIYELTSPKQSHFRQLLWALVGAREDTVRR
ALKQPGLILQYAAWFTRPQKSAAGLHAILSAWLTDLNADQYTPIEVIQCEPQRLSIPTGNLLALGTGNTA
GFGNAAGTGKALGIDTVLGTSIIDYSGKLLVRLGPLSTTTYRQLVPEGHPCHEAGVGLLIRTYIGPSLNC
DLEFLVTPTPSTPITLQLGEPTTNPLGLGSWLGAPADATPQTHFTARLRLQ
 
Nucleotide Sequence: 1206 bp     [Download]
>gi|304309652|ref|NC_014366.1|:c1493746-1492541 Gamma proteobacterium HdN1 chromosome, complete genome
ATGAATACGCCAGAAAAAAGCCTGACCCCCGCGCTCGAAGCCGCACTACTGCAACGCGGTGACACCTTCT
CCTATCTGCAAGCATACCGGCTGCTGGCACAAGCCCTCAGCGAGCAAGGCAACAACCCCGAAACCGCTCT
GCGCCTGCGCCCAGCACTCAGCCTTGCCCTACCCCGCGCAGCCATCCAGCAAATCAGCACCTACAGCGCC
GAAAGCTCTGTCCACAAAAGCTCCGTCGAACAAAGCTCCGCAGAAGAACGCTCTGTAGAAGAAAGATCAG
CAGAAAACGCGCGAGAAACCCCCTCCGAAAACAAATCGGACGAATACTCACAAAGCCAAGCTCACAACCC
CAAAACCAGCCGCTACGAAATCCAAGCAAACTTTCTAGGTCTCTATGGTGCCAGCTCCCCACTCCCGAAC
TTTTACACGGAAGACCTGATAACCGGCGAACAAGAAGACCAGCTCCAAGCCCGCCAACTCCTCGACATCT
TTCACCAACGCGCCTATCACCTCTACGCCGCTGCCCTGCAGAAATACCGCCCCATTTACGAACTCACCAG
CCCCAAACAAAGCCACTTTCGCCAGTTACTTTGGGCATTAGTCGGTGCGCGAGAAGACACCGTACGGCGC
GCCTTAAAACAGCCTGGCCTGATTCTGCAATATGCCGCGTGGTTCACCCGCCCACAGAAATCTGCCGCCG
GCTTACACGCCATTCTTTCTGCTTGGCTCACCGATCTCAACGCCGATCAATACACGCCCATTGAAGTCAT
CCAGTGCGAACCTCAGCGCCTCAGCATCCCTACCGGCAACCTCTTGGCACTCGGTACTGGAAACACCGCC
GGTTTTGGAAACGCGGCCGGCACCGGAAAAGCCCTCGGCATTGACACCGTACTGGGCACAAGCATCATAG
ACTACAGCGGCAAGCTCCTTGTGCGTCTAGGCCCCCTCTCCACCACGACCTACCGCCAACTGGTTCCAGA
AGGCCACCCCTGCCACGAAGCGGGGGTGGGCCTACTCATCCGCACCTACATCGGCCCCAGCCTCAACTGC
GATCTAGAATTTCTTGTGACCCCCACCCCAAGCACCCCAATCACCCTCCAACTCGGCGAACCCACTACCA
ACCCGCTTGGGCTCGGCAGCTGGCTGGGCGCCCCCGCAGATGCGACGCCGCAAACGCACTTTACTGCGCG
CCTCCGATTGCAGTGA