SecReT6
Protein ID: 304310845
SecReT6 ID408
T6SS typei1
Gene symbol-
Locus tagHDN1F_12070
StrainGamma proteobacterium HdN1
Repliconchromosome [GenBank: NC_014366] [Browse all T6SS(s) in this replicon]
Location [Strand]1493887..1495713 [-]
Producthypothetical protein
NoteTssF
UniProt IDE1VIZ8
KEGG IDgpb:HDN1F_12070
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.50E-142, Aligned region: 8..608
Protein Sequence: 608 a.a.     [Download]
>gi|304310845|ref|YP_003810443.1| unnamed protein product [gamma proteobacterium HdN1]
MSTDLTQKDYYRRELGHLRETASLFAEENPAIAGNLRNITSDPDVERLLEGFAFLTAGIHQELDDNYPRL
LQALAQIIAPQYLRPLASATLIEFTPRASLQQTLTIRAGVHIDGSTTNAPAATNAPAAVNTPTAATCRYR
TTCATTVHPLKISNIQFQEQETRSSITADAQPHVSLTVRFELLNGSLPTLQLSTLRLHLGGNQTEASDLL
YLLLGHTERIEIRTSPQDIYYTATPSILHHGGFSAEESLSGPRPNQLPAFQQLREYFLFPEKFLFIDIDL
SQWKTRPETGYFELILRCRRPSFELPKLNPDSLLLHITPAVNLFSLEAAPLVLDQRDTELLVVPARDTSG
LGTNAHIHSVDRVEGIVRGRPERRRFHAVSGTNLEDPQLARFIVHHREHALRNRTETWITLATPPGTLLH
EREVLKISLTCHNGEAVEHLQRGDICRNTGETPELVTPRNITVPTRNQRPIPEGDLSWHLLADLNLNYAS
LTDLDSLRALLRHYLPLHGHDDTRLTSARRHVEAIEKLSVHPTQTFYRDAFIRGLRIRLTVRGDHFSSEG
DKYLFGCLLDHLFASTSTFNTFTTLELEDFHSGAVISWPTRLGHKPLL
 
Nucleotide Sequence: 1827 bp     [Download]
>gi|304309652|ref|NC_014366.1|:c1495713-1493887 Gamma proteobacterium HdN1 chromosome, complete genome
ATGTCTACCGATCTTACACAAAAAGACTACTACCGCCGCGAACTCGGCCACCTGCGCGAAACCGCCAGCC
TGTTCGCCGAAGAAAACCCCGCCATCGCTGGAAACCTCCGCAACATCACCAGCGACCCCGATGTCGAGCG
CCTCCTCGAAGGCTTTGCCTTCCTCACCGCCGGCATCCATCAGGAGCTCGATGACAACTATCCTCGACTT
CTGCAAGCCCTCGCGCAAATCATCGCCCCGCAATACTTGCGCCCGCTGGCCTCTGCAACCCTGATCGAAT
TCACCCCACGCGCCAGCCTTCAGCAAACACTCACCATCCGCGCCGGCGTTCACATCGACGGTTCCACCAC
AAACGCACCTGCGGCCACAAACGCACCGGCTGCCGTAAACACACCGACTGCCGCCACCTGCCGCTACCGC
ACCACCTGCGCCACCACGGTTCACCCCCTAAAGATCAGCAACATCCAATTTCAAGAGCAAGAAACCCGCA
GCAGCATAACCGCCGACGCACAACCCCACGTAAGCCTTACGGTGCGCTTCGAACTGCTCAACGGCAGCCT
GCCAACACTCCAACTCTCCACCCTGCGCCTCCACCTTGGCGGCAACCAGACCGAAGCCAGCGACCTGCTC
TATCTCCTGCTTGGGCACACCGAGCGCATTGAAATCCGCACATCCCCCCAAGACATCTACTACACCGCCA
CCCCCAGCATCCTGCATCACGGCGGATTCAGCGCCGAAGAATCGCTCTCCGGCCCGCGTCCCAACCAACT
TCCCGCGTTCCAGCAGCTCCGCGAATATTTTCTGTTTCCAGAAAAATTCCTGTTTATCGACATCGACCTC
AGCCAATGGAAAACCCGCCCAGAAACCGGCTATTTTGAGCTGATTCTGCGCTGCCGACGCCCAAGCTTTG
AACTTCCCAAACTCAACCCCGACAGCCTGCTACTGCACATCACACCCGCCGTTAACCTATTCTCCCTTGA
AGCCGCCCCCCTCGTCCTTGACCAGCGCGACACCGAATTACTCGTCGTTCCAGCGCGCGACACCAGCGGC
CTAGGCACAAACGCCCATATTCACAGCGTTGATCGCGTTGAAGGCATCGTCCGTGGCCGCCCCGAGCGAC
GCCGTTTTCACGCCGTCTCCGGAACCAACCTTGAAGACCCACAGCTCGCTCGTTTTATCGTCCATCACCG
CGAACATGCACTACGCAACCGTACCGAAACCTGGATCACCCTCGCCACTCCACCCGGCACGTTACTTCAC
GAGCGCGAAGTCCTCAAGATCAGCCTCACCTGTCACAACGGCGAAGCGGTCGAACACCTCCAGCGCGGCG
ACATCTGCCGCAACACCGGCGAAACGCCAGAACTCGTCACCCCACGCAACATCACCGTCCCCACCCGCAA
CCAACGCCCCATCCCCGAAGGCGACCTCTCGTGGCACCTATTGGCAGATCTCAACCTCAACTACGCCTCA
CTGACCGACCTCGATAGCCTCCGCGCCCTCCTGCGGCACTACCTCCCCCTGCACGGCCACGATGACACCC
GCCTCACCAGCGCCCGCCGCCACGTAGAAGCAATCGAAAAACTCAGCGTCCACCCCACCCAAACCTTCTA
CCGCGACGCCTTTATCCGTGGTCTGCGCATCCGCCTCACTGTACGAGGCGACCACTTTTCCAGCGAGGGC
GATAAATACCTCTTTGGCTGCCTGCTCGACCACCTGTTTGCATCGACCAGCACATTCAACACATTCACCA
CCCTTGAACTCGAAGACTTTCACAGTGGCGCCGTGATCTCATGGCCAACTCGCCTAGGCCACAAGCCCCT
ACTGTAA