SecReT6
Protein ID: 304310846
SecReT6 ID408
T6SS typei1
Gene symbol-
Locus tagHDN1F_12080
StrainGamma proteobacterium HdN1
Repliconchromosome [GenBank: NC_014366] [Browse all T6SS(s) in this replicon]
Location [Strand]1495734..1496264 [-]
Producthypothetical protein
NoteTssE
UniProt IDE1VIZ9
KEGG IDgpb:HDN1F_12080
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.50E-17, Aligned region: 56..129
Protein Sequence: 176 a.a.     [Download]
>gi|304310846|ref|YP_003810444.1| unnamed protein product [gamma proteobacterium HdN1]
MQRLLERLTQPRQRQPLLSTATSLSTATSLSATTNAFSASTGIPSRFGTHDTPEQISIRNHLQRLLNTRR
GSALIDSDYGMPTLATGPGNNSLSDREAIAHEIQRTITRYETRLTHVQVRVLSPASPNSIGLLCEIRGQW
IQPLQASARPSDSPMAPIELQGSLLSDGTFDFTKTP
 
Nucleotide Sequence: 531 bp     [Download]
>gi|304309652|ref|NC_014366.1|:c1496264-1495734 Gamma proteobacterium HdN1 chromosome, complete genome
ATGCAACGCCTGCTCGAACGCCTCACCCAGCCCCGCCAACGGCAGCCACTCTTATCCACTGCTACAAGCT
TATCCACTGCGACAAGCTTATCTGCAACGACAAACGCTTTCAGCGCATCAACCGGCATACCATCTCGCTT
TGGTACACACGACACGCCCGAACAAATCTCCATCCGCAACCACCTTCAGCGTCTCCTGAACACCCGGCGC
GGCAGCGCACTGATCGACAGCGACTACGGAATGCCCACCCTCGCCACCGGCCCCGGTAACAACAGCCTAA
GCGACCGAGAAGCCATCGCCCACGAGATTCAGCGCACCATCACGCGCTATGAAACGCGCCTCACCCATGT
TCAGGTACGGGTTTTGTCGCCCGCATCCCCCAATTCCATCGGCCTGCTCTGCGAAATTCGTGGCCAATGG
ATACAACCGCTGCAAGCCTCTGCACGGCCAAGCGACTCCCCAATGGCACCCATTGAACTGCAAGGCAGCC
TACTTAGCGATGGCACCTTCGACTTCACAAAAACCCCCTAA