SecReT6
Protein ID: 304310847
SecReT6 ID408
T6SS typei1
Gene symbolhcP-2
Locus tagHDN1F_12090
StrainGamma proteobacterium HdN1
Repliconchromosome [GenBank: NC_014366] [Browse all T6SS(s) in this replicon]
Location [Strand]1496299..1496793 [-]
Producthypothetical protein
NoteTssD
UniProt IDE1VJ00
KEGG IDgpb:HDN1F_12090
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.20E-31, Aligned region: 6..147
Protein Sequence: 164 a.a.     [Download]
>gi|304310847|ref|YP_003810445.1| hcP-2 gene product [gamma proteobacterium HdN1]
MECSAYLELTGSEQGTLLGDCQKRGRENLIELLEFQHCVEIILGSTGQHAGTGKATHRPIEFTKEIDRST
PKLYQALCQRERLDSAHFRWYRYTSQGAEDLYYSIRLENARILCIQPWTPNPLSPKDDHHRYMERIRLGY
ERITWSWGPEGSVEYETDWFQQAE
 
Nucleotide Sequence: 495 bp     [Download]
>gi|304309652|ref|NC_014366.1|:c1496793-1496299 Gamma proteobacterium HdN1 chromosome, complete genome
ATGGAATGTTCCGCCTACCTTGAACTCACCGGCAGCGAACAAGGCACCCTTCTCGGCGACTGCCAAAAGC
GCGGGCGAGAAAACCTGATCGAACTCCTCGAATTCCAGCACTGCGTCGAAATCATCCTCGGTAGCACCGG
CCAACACGCCGGTACCGGAAAAGCCACCCATCGCCCCATCGAATTCACCAAAGAAATCGACCGCAGCACC
CCCAAGCTGTACCAGGCCCTCTGCCAACGCGAGCGCTTGGATAGCGCCCACTTCCGATGGTATCGCTACA
CCAGCCAAGGTGCAGAAGATCTGTACTACAGCATTCGCCTCGAAAACGCCCGTATCCTCTGCATCCAACC
CTGGACACCCAACCCACTTTCGCCCAAAGACGACCACCACCGCTACATGGAACGCATCCGTCTAGGCTAC
GAGCGCATCACTTGGAGCTGGGGCCCAGAAGGCAGCGTCGAATACGAAACCGATTGGTTCCAGCAAGCAG
AATAG