SecReT6
Protein ID: 304310848
SecReT6 ID408
T6SS typei1
Gene symbol-
Locus tagHDN1F_12100
StrainGamma proteobacterium HdN1
Repliconchromosome [GenBank: NC_014366] [Browse all T6SS(s) in this replicon]
Location [Strand]1496869..1498737 [-]
Producthypothetical protein
NoteTssC
UniProt IDE1VJ01
KEGG IDgpb:HDN1F_12100
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.30E-120, Aligned region: 189..615
DUF770 [PF05591], Evalue: 1.60E-08, Aligned region: 13..126
PT [PF04886], Evalue: 5.00E-05, Aligned region: 87..91
PT [PF04886], Evalue: 5.00E-05, Aligned region: 129..160
Casein_kappa [PF00997], Evalue: 0.0098, Aligned region: 127..164
Casein_kappa [PF00997], Evalue: 0.0098, Aligned region: 459..482
Protein Sequence: 622 a.a.     [Download]
>gi|304310848|ref|YP_003810446.1| unnamed protein product [gamma proteobacterium HdN1]
MNASDSQASFQFSYAPEGGSANEIQLPFRLLVLGEFLPSQTEDDYLNTAPSAITRRSFEQQMAAQQIRLQ
LPTHELNLSDSTRQWLPTGQPLPLELRTLEDFHPEILTQRQPSLAYIKELLTNLQTARQSTVNPTVNPTV
NPTVNPTVNPTVNPTVNPSASIRLTLNADDRQRLQLPDAPVSADVLELIVTDVAATLNELLNAILHHPRF
QKLEASWRSLHLLTQTAGDHPETQISFLPAHLPNLREDLSRAPTLADSHLFDVLYTHEYGQFGGKPYGAL
IVDHAFDLHTDDLQLLRRLAQLGSIAHAPILTQVAPTFFGVNDYGELAQLDSLASIPNGDRYIHWRALKA
SPEANYLVLTLPRILLRAPWSTRTGNVPSLLFEEDIDSSTHALLWGNAAYALGTCMLRSFQQFGICTDLT
GEHGGAVTCLPPLPLKNTHSTLLPVEVILSETKEAELIHQGFTPISIAKAQEKILFRAANAIHWGHLSNL
QKSASSLTNQHREAQTSSVTLDHLSSRLPYLFIILRIAHYLKMICRDLIGSSASMADIEIELQRWLRRYV
AEVENPSHAVRSRRPLKKASLTLSADPNYNGWMNIALSITPHMKYMDQDVTLNLDIKATQQP
 
Nucleotide Sequence: 1869 bp     [Download]
>gi|304309652|ref|NC_014366.1|:c1498737-1496869 Gamma proteobacterium HdN1 chromosome, complete genome
ATGAATGCAAGCGACTCCCAGGCCAGCTTCCAGTTTTCCTACGCACCCGAAGGCGGATCTGCAAACGAAA
TCCAGCTTCCCTTCCGCCTGCTCGTGCTCGGTGAATTTCTGCCCAGCCAAACCGAAGATGACTACCTGAA
CACCGCCCCTTCCGCCATCACCCGACGCAGCTTCGAGCAACAGATGGCCGCCCAACAAATCAGGCTACAG
CTCCCCACCCACGAGCTCAACCTGAGCGACAGCACCCGCCAGTGGCTCCCCACCGGCCAGCCACTACCGC
TGGAACTTCGCACATTGGAAGACTTCCACCCCGAAATTCTCACCCAGCGCCAGCCAAGCCTTGCCTACAT
CAAGGAACTGCTGACAAACCTGCAGACCGCACGACAGTCCACTGTAAACCCCACTGTAAACCCCACTGTA
AACCCCACTGTAAACCCCACTGTAAACCCCACTGTAAACCCCACTGTAAACCCAAGCGCTAGCATCCGCC
TCACACTCAATGCCGACGACCGCCAGCGCCTACAACTACCCGACGCCCCCGTGAGCGCTGACGTACTTGA
ACTCATCGTGACCGATGTTGCCGCAACCCTGAACGAATTGCTCAACGCCATCCTGCACCATCCCCGCTTT
CAAAAACTGGAAGCCAGTTGGCGAAGCCTGCACCTGCTGACCCAAACCGCAGGTGATCACCCTGAAACCC
AAATCAGCTTCCTACCCGCGCATCTCCCCAACCTACGCGAAGACCTCAGCCGCGCACCAACCCTCGCCGA
CAGTCACCTGTTCGACGTCCTCTATACACACGAATACGGCCAGTTTGGCGGAAAGCCCTACGGCGCGCTG
ATCGTTGATCATGCCTTCGACCTACACACCGATGACCTGCAACTACTGCGCCGCCTCGCTCAACTCGGCA
GCATCGCACACGCACCGATCCTAACGCAGGTTGCGCCGACCTTCTTCGGCGTCAACGACTACGGCGAACT
TGCCCAGCTCGACAGCCTCGCAAGCATCCCCAACGGCGATCGCTACATCCACTGGCGCGCACTCAAAGCC
AGCCCAGAAGCCAACTACCTCGTGCTCACTTTGCCACGCATCCTGTTACGCGCACCGTGGAGCACTCGCA
CTGGCAACGTGCCCTCCCTATTGTTCGAAGAAGACATCGACAGCAGCACCCACGCATTGCTCTGGGGCAA
CGCAGCCTACGCACTCGGCACCTGCATGCTTCGCAGCTTTCAACAGTTTGGCATCTGCACCGACCTAACG
GGAGAACACGGCGGCGCCGTCACCTGCCTCCCACCGCTGCCCCTGAAAAACACCCACAGCACCTTACTGC
CCGTCGAAGTCATCCTTTCGGAAACCAAAGAAGCGGAACTGATACACCAAGGATTTACGCCGATCAGCAT
CGCCAAAGCGCAGGAAAAAATCCTGTTTCGAGCCGCCAATGCCATCCACTGGGGCCACCTGTCCAACCTG
CAGAAGAGTGCATCCTCGCTGACCAATCAACACCGAGAAGCACAAACATCATCCGTCACCCTCGACCACC
TTAGCTCACGGCTGCCCTACCTGTTCATCATCCTACGCATCGCCCACTACCTGAAAATGATCTGCCGCGA
CTTGATCGGCAGCAGCGCGAGCATGGCCGACATTGAGATCGAACTACAGCGCTGGCTGCGCCGCTACGTT
GCCGAAGTCGAAAACCCAAGCCACGCAGTGCGCTCACGTCGCCCACTGAAAAAGGCCAGCCTCACCCTAA
GCGCCGACCCAAACTACAACGGCTGGATGAACATCGCCCTCAGCATCACACCGCACATGAAATACATGGA
TCAAGATGTAACTTTGAATCTCGACATCAAGGCCACCCAACAACCGTGA