SecReT6
Protein ID: 304310851
SecReT6 ID408
T6SS typei1
Gene symbol-
Locus tagHDN1F_12130
StrainGamma proteobacterium HdN1
Repliconchromosome [GenBank: NC_014366] [Browse all T6SS(s) in this replicon]
Location [Strand]1503097..1504488 [-]
Producthypothetical protein
NoteTssK
UniProt IDE1VJ04
KEGG IDgpb:HDN1F_12130
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.70E-85, Aligned region: 19..462
Protein Sequence: 463 a.a.     [Download]
>gi|304310851|ref|YP_003810449.1| unnamed protein product [gamma proteobacterium HdN1]
MKLIRPLLWHQGLFLQPQHLQYADQYHRDFATALVAHTRPHHSGLIELDIDQDALRSGAFQCKQIEALFP
CGTWICFPGNAILPPRNFETYWVDRKQNLTVWLALKRLLPGDTNLTVTGSRHESASAKTRYVTSNTGTEY
PDNFQNSGSAQVKPIDYVLQFCFGNEPEDLEEYIFLPVAEITQEGKEYRISEHFIPPCINIGASRAITNT
LLTLKSNLMGRARLLESYKSSGANDRTALSNAALNNHLALQTLARYIPLLVHLVEGERIHPFDVYGVLRQ
LAGELSVFSNKMDVGIEAGDTDLSLPPYDHQRLGHCFYRALDIIGQVLGELTIGPELLVSLKREESGKFA
GVLTREFFERKHSVYLLLRTRENFSDLAANFLNHAKLGATGQVDVYARRSLPGVHLMHLQGKPIGVTGQA
NTQYFMIEKEGHEWGYIQDGGQIGLIWNNAPPDLAVDIVLVRG
 
Nucleotide Sequence: 1392 bp     [Download]
>gi|304309652|ref|NC_014366.1|:c1504488-1503097 Gamma proteobacterium HdN1 chromosome, complete genome
GTGAAACTCATCAGGCCCCTGCTTTGGCACCAAGGACTTTTCCTTCAGCCCCAGCATTTGCAGTATGCAG
ACCAATACCATCGGGATTTCGCTACGGCCCTAGTTGCCCACACGCGCCCACACCATTCCGGCCTGATCGA
ACTGGATATTGATCAGGATGCACTACGCTCCGGCGCGTTTCAGTGCAAACAGATTGAAGCCCTATTTCCG
TGCGGCACATGGATTTGTTTTCCGGGAAACGCCATCTTGCCACCACGCAATTTTGAAACCTACTGGGTGG
ATCGCAAGCAAAATCTGACTGTATGGCTGGCATTGAAGCGGCTCCTCCCCGGTGATACCAACCTCACGGT
TACAGGAAGCCGCCACGAATCGGCAAGTGCAAAAACTCGATACGTTACCAGCAATACCGGCACTGAATAC
CCTGACAACTTCCAGAATTCTGGCAGCGCTCAGGTGAAGCCAATCGACTATGTGCTTCAGTTTTGTTTTG
GAAACGAACCTGAAGACCTAGAAGAATATATCTTCCTTCCGGTTGCTGAAATCACACAGGAAGGCAAAGA
ATATCGCATTAGCGAACACTTTATTCCCCCTTGTATTAATATCGGCGCATCACGTGCCATTACCAACACG
CTGCTCACGCTAAAAAGCAATTTGATGGGGCGGGCTCGGCTGCTCGAAAGCTATAAATCATCCGGCGCGA
ACGACCGCACCGCCCTCAGCAACGCGGCATTGAACAACCACCTCGCGCTGCAAACGCTTGCCCGTTACAT
CCCACTGCTTGTCCATCTCGTAGAAGGCGAACGCATCCATCCCTTCGACGTATACGGCGTCCTGCGACAA
CTCGCGGGCGAACTCTCGGTTTTTTCCAACAAAATGGATGTCGGCATCGAAGCAGGCGATACCGACCTAA
GCCTTCCTCCCTACGACCATCAACGCTTAGGCCACTGTTTTTACCGCGCACTCGATATCATCGGCCAAGT
ACTGGGCGAATTGACCATTGGCCCTGAACTGCTCGTTTCTCTAAAACGCGAAGAATCCGGAAAATTTGCA
GGTGTCCTTACGCGCGAATTTTTCGAGCGCAAGCACAGCGTTTATCTACTCTTGCGTACCCGAGAAAACT
TCAGCGACCTTGCCGCAAACTTTCTCAACCACGCCAAACTCGGCGCCACCGGCCAAGTGGACGTATACGC
ACGACGCTCGTTACCGGGTGTCCACTTGATGCATCTCCAGGGAAAGCCGATTGGCGTTACCGGCCAAGCC
AATACGCAGTATTTCATGATCGAAAAAGAAGGCCACGAATGGGGCTACATTCAGGATGGCGGTCAGATCG
GGCTGATCTGGAACAATGCGCCCCCAGACCTTGCCGTCGATATCGTACTTGTGCGCGGTTAA