SecReT6
Protein ID: 304310852
SecReT6 ID408
T6SS typei1
Gene symbol-
Locus tagHDN1F_12140
StrainGamma proteobacterium HdN1
Repliconchromosome [GenBank: NC_014366] [Browse all T6SS(s) in this replicon]
Location [Strand]1504530..1505294 [-]
Producthypothetical protein
NoteTssJ
UniProt IDE1VJ05
KEGG IDgpb:HDN1F_12140
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 5.80E-19, Aligned region: 24..207
Protein Sequence: 254 a.a.     [Download]
>gi|304310852|ref|YP_003810450.1| unnamed protein product [gamma proteobacterium HdN1]
MNRISLRLLTRTTSVWAAHFLLIVTLAGCSMLPFGKPAPAIDPALDDDPAAFAEFEQNAGNSLWEWNDTR
QRWHYTIENTTPPRLAQDAWPLDEGAIQLRILAAPQSNLHRGRPHALIVRVIQMSDAKPFQVRRDNLFGL
KEMLTVNDFDKTAVLSVNDYSILPGSEQMLTLDRLENSRYIGIVAGFFELNGRQSARLIAIPPTDTRSTT
KRWIQRLSFGFFGAPDASSLRAARLKILLQIGTDKIDSLRIRAD
 
Nucleotide Sequence: 765 bp     [Download]
>gi|304309652|ref|NC_014366.1|:c1505294-1504530 Gamma proteobacterium HdN1 chromosome, complete genome
ATGAATCGCATTTCGCTACGACTTTTAACCCGCACAACCAGCGTTTGGGCAGCGCACTTCCTGCTGATCG
TTACGCTAGCGGGGTGCAGCATGCTGCCATTTGGCAAACCCGCACCCGCTATCGACCCTGCGCTGGATGA
CGATCCGGCAGCATTTGCAGAATTCGAGCAGAATGCAGGAAACAGCTTGTGGGAGTGGAATGATACGCGC
CAACGCTGGCATTACACCATTGAAAACACCACACCTCCTCGTTTGGCACAGGATGCATGGCCGCTCGACG
AAGGGGCAATTCAATTACGCATTCTGGCCGCACCACAGTCGAATCTACATCGTGGACGCCCACACGCACT
CATTGTGCGCGTTATTCAAATGAGTGATGCCAAACCTTTTCAGGTAAGGCGTGACAACCTCTTTGGACTA
AAAGAAATGCTTACGGTGAATGATTTTGACAAAACCGCAGTACTTAGCGTGAACGATTACTCCATTCTGC
CTGGCTCAGAGCAAATGCTCACGCTTGATCGCTTGGAGAACAGCCGTTATATCGGAATCGTTGCGGGATT
TTTTGAACTGAACGGCCGCCAGTCTGCCCGCCTGATTGCCATTCCCCCCACCGATACGCGCTCCACCACG
AAGCGCTGGATTCAACGATTAAGCTTTGGTTTTTTTGGCGCACCCGATGCGAGTTCGCTTCGAGCGGCTA
GACTGAAAATACTGTTGCAAATCGGAACCGACAAAATCGACAGCCTACGAATTCGCGCTGACTAG