SecReT6
Protein ID: 304310853
SecReT6 ID408
T6SS typei1
Gene symbol-
Locus tagHDN1F_12150
StrainGamma proteobacterium HdN1
Repliconchromosome [GenBank: NC_014366] [Browse all T6SS(s) in this replicon]
Location [Strand]1505371..1505889 [-]
Producthypothetical protein
NoteTssD
UniProt IDE1VJ06
KEGG IDgpb:HDN1F_12150
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.70E-27, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|304310853|ref|YP_003810451.1| unnamed protein product [gamma proteobacterium HdN1]
MPTEIYMSINDPDACLTEGACSKESIGSFFKAEHDEEALILAFEHKVSVPINNLTGQVTGTRKHEYLRVT
KFIDKSSPLLLNTVTAPTELEVEFQFFRTPDETSAGEPVHYYTVALKRAKIVSIESISPNIMDVATEGYM
PYEVVTFTYGQIQADHVVCGTNAIDDWSGEGS
 
Nucleotide Sequence: 519 bp     [Download]
>gi|304309652|ref|NC_014366.1|:c1505889-1505371 Gamma proteobacterium HdN1 chromosome, complete genome
ATGCCAACCGAGATTTATATGTCTATCAACGATCCAGACGCCTGCCTAACCGAAGGTGCCTGCTCCAAAG
AAAGCATCGGTTCCTTTTTCAAGGCCGAGCACGATGAGGAAGCACTCATCCTCGCCTTTGAACACAAAGT
CAGTGTGCCAATTAACAATCTCACAGGGCAGGTTACAGGCACACGCAAACATGAATATTTGCGCGTTACA
AAATTCATTGACAAAAGCTCACCGCTATTGCTGAACACCGTCACCGCCCCCACGGAACTGGAAGTGGAAT
TTCAGTTTTTCCGCACTCCAGATGAAACGAGCGCAGGCGAGCCCGTACACTATTACACCGTAGCCCTCAA
ACGCGCCAAAATTGTCAGCATCGAATCCATTTCGCCCAACATCATGGACGTTGCAACCGAAGGCTACATG
CCCTACGAAGTGGTCACCTTCACCTACGGGCAGATCCAGGCCGACCACGTTGTATGCGGCACCAATGCGA
TCGACGACTGGTCGGGTGAAGGCTCATAA