SecReT6
Protein ID: 304310854
SecReT6 ID408
T6SS typei1
Gene symbol-
Locus tagHDN1F_12160
StrainGamma proteobacterium HdN1
Repliconchromosome [GenBank: NC_014366] [Browse all T6SS(s) in this replicon]
Location [Strand]1505977..1507449 [-]
Producthypothetical protein
NoteTssC
UniProt IDE1VJ07
KEGG IDgpb:HDN1F_12160
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.20E-167, Aligned region: 65..487
Protein Sequence: 490 a.a.     [Download]
>gi|304310854|ref|YP_003810452.1| unnamed protein product [gamma proteobacterium HdN1]
MVSFSGQVSETEVIDSPMLDEILEFTRLPRQDDSYLVARNGVKAMLEEVFRKSEDDTVRIDKLFIDELIN
ELDQVISRQMDAILHHPEFQRIEAPWRSMKFLVDRTDFSENIKLEYINATKDDLLADFEDAAGVVDSGLF
RQLYTEEFGQFGGEPVGAIIGNFEFSPGSEDIKLLEYLASLSAMTHAPFIAAAGPEFFGLGDYSGLPQIK
QLEAIFDGPQYMKWRGLRESDDARNIGLAMPRFMLRGTYGDQIGVRSFNYRESISGKTDFLWGNAAFSYA
TRLTESFASYRWCPNIIGPQSGGATVDMPVHISEENGRTDVNGPVEITISDRKEYELSELGFIPFTMRKD
SDSAVFFSSNSIQKPKLFGNDDEGKQAELNYRLGTQMPYLFIVNRLAHYIKVLQRENLGSWKSRGDIEME
LNKWIRQYVADQENPSASTRSQRPLRKANLKVSEVDGEAGWYRVALEITPHFKFMGANFTLSLASMIERA
 
Nucleotide Sequence: 1473 bp     [Download]
>gi|304309652|ref|NC_014366.1|:c1507449-1505977 Gamma proteobacterium HdN1 chromosome, complete genome
ATGGTAAGTTTTTCCGGTCAGGTTTCTGAAACCGAAGTAATTGATTCGCCAATGCTCGACGAAATTCTCG
AATTCACCCGTCTTCCTCGGCAAGATGACAGCTATCTGGTTGCACGTAACGGCGTTAAAGCGATGTTGGA
AGAAGTCTTCCGCAAATCGGAAGACGACACTGTTCGTATCGACAAACTGTTTATTGATGAGCTCATCAAC
GAACTCGACCAAGTCATTAGCCGACAAATGGATGCCATACTGCATCATCCGGAATTTCAGCGTATTGAAG
CCCCATGGCGCAGCATGAAATTCCTTGTTGATCGCACGGATTTTAGCGAGAACATTAAACTCGAATACAT
CAACGCAACCAAAGACGATTTACTTGCAGACTTCGAAGACGCCGCCGGCGTTGTAGATTCGGGCCTGTTT
CGCCAACTCTACACCGAGGAATTCGGCCAGTTTGGCGGTGAACCAGTTGGCGCCATTATCGGCAACTTCG
AATTTTCTCCCGGTTCTGAAGACATTAAGCTACTGGAATACTTGGCAAGCCTGAGCGCAATGACACATGC
GCCATTTATCGCAGCCGCCGGCCCTGAATTCTTTGGCCTAGGTGACTACAGCGGCCTACCACAAATCAAG
CAGCTTGAAGCCATTTTTGACGGCCCACAGTACATGAAATGGCGCGGCCTGCGCGAATCGGACGATGCCC
GCAATATCGGCCTCGCAATGCCGCGCTTTATGCTACGTGGCACCTACGGAGATCAGATCGGCGTACGCTC
CTTCAATTACCGTGAGAGCATTTCCGGAAAAACCGATTTTCTTTGGGGAAACGCAGCGTTTAGCTACGCT
ACTCGACTGACGGAAAGCTTTGCCAGCTATCGCTGGTGTCCAAACATCATCGGACCACAATCTGGCGGCG
CAACCGTGGATATGCCAGTCCATATTTCGGAAGAAAATGGCCGCACCGATGTCAATGGCCCAGTGGAAAT
CACCATTTCTGACCGCAAGGAATACGAGTTGTCAGAACTTGGATTTATTCCCTTTACCATGCGCAAAGAT
TCGGATAGCGCGGTTTTCTTCTCATCCAACTCCATCCAAAAACCAAAACTATTCGGCAACGACGACGAAG
GCAAGCAGGCGGAGCTGAACTATCGCCTCGGCACGCAAATGCCCTACCTGTTCATCGTCAACCGGCTCGC
ACACTACATCAAGGTATTGCAGCGCGAGAACCTTGGCAGTTGGAAAAGCCGTGGCGACATCGAAATGGAA
TTGAATAAGTGGATTCGCCAGTACGTTGCCGATCAGGAAAACCCCTCTGCATCCACACGCAGCCAGCGCC
CATTACGCAAAGCAAACCTCAAGGTCAGCGAAGTGGACGGCGAAGCCGGCTGGTACCGGGTTGCGCTTGA
AATCACGCCACATTTCAAATTCATGGGCGCCAATTTTACCCTCTCTCTGGCAAGCATGATCGAGCGGGCC
TAA