SecReT6
Protein ID: 304310855
SecReT6 ID408
T6SS typei1
Gene symbol-
Locus tagHDN1F_12170
StrainGamma proteobacterium HdN1
Repliconchromosome [GenBank: NC_014366] [Browse all T6SS(s) in this replicon]
Location [Strand]1507524..1508012 [-]
Producthypothetical protein
NoteTssB
UniProt IDE1VJ08
KEGG IDgpb:HDN1F_12170
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.00E-50, Aligned region: 7..160
Protein Sequence: 162 a.a.     [Download]
>gi|304310855|ref|YP_003810453.1| unnamed protein product [gamma proteobacterium HdN1]
MAKKNSGSVAPKERINISYKPATGNARETVELPFKLVVLGDFTNKQDDRTVEDRAPVEVNKHNFDDVMKG
ANLSLQFSVDNHLSQQENSEISVDIPVQSLKDLEPDSLMKLIPELRRVHELRESLMALKGPLGNSPQMRR
TIMAMIQDKEQRGRLMQEIGLR
 
Nucleotide Sequence: 489 bp     [Download]
>gi|304309652|ref|NC_014366.1|:c1508012-1507524 Gamma proteobacterium HdN1 chromosome, complete genome
ATGGCAAAAAAGAACAGCGGTTCAGTTGCACCGAAAGAGCGTATCAATATTTCCTACAAACCGGCGACGG
GAAACGCTAGAGAAACCGTCGAACTCCCTTTTAAATTAGTCGTTCTTGGTGACTTCACCAACAAACAGGA
CGACCGTACCGTCGAAGACCGCGCGCCCGTAGAAGTCAACAAGCACAACTTCGACGACGTGATGAAAGGG
GCGAATCTCTCCCTGCAGTTTTCGGTAGACAATCACCTCAGCCAACAAGAAAACTCTGAAATTTCCGTAG
ACATTCCAGTGCAGTCGCTCAAGGATCTTGAACCCGACAGCCTGATGAAATTGATCCCAGAGCTTCGCCG
AGTTCACGAGCTAAGAGAGTCGCTCATGGCGCTCAAAGGGCCGCTTGGGAACAGTCCACAAATGCGTAGA
ACCATCATGGCAATGATACAAGACAAAGAGCAGCGCGGTCGATTGATGCAAGAAATCGGGCTTCGCTAA