SecReT6
Protein ID: 304310867
SecReT6 ID408
T6SS typei1
Gene symbol-
Locus tagHDN1F_12290
StrainGamma proteobacterium HdN1
Repliconchromosome [GenBank: NC_014366] [Browse all T6SS(s) in this replicon]
Location [Strand]1521464..1524319 [-]
Producthypothetical protein
NoteTssI
UniProt IDE1VJ20
KEGG IDgpb:HDN1F_12290
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.10E-55, Aligned region: 33..334
Phage_base_V [PF04717], Evalue: 1.40E-14, Aligned region: 395..469
Protein Sequence: 951 a.a.     [Download]
>gi|304310867|ref|YP_003810465.1| unnamed protein product [gamma proteobacterium HdN1]
MGRFSMVDAVQFSFTSQSLPQYKFIVNRFQGDEGLSQLYHFEIELRTRNTDIDLDQVLQASWQLAITTHG
QKRLINGIVSECEMLRHVEGFDLYRACLVPHIWQLGQYHANEVYLDKTVPDILRAVLGEANFSSMDYELH
LNEGSYRKWPYRCQYDETHLDFIKRLMEREGIYFWFTQKADGEKLIIADSLQTHEDMPSPNVKYDPSSGL
EGEHFENSVQSLVCRQKRLPQLLTLRDYNDNKPSVDIKGECNVDPNGVGEINLFGLNIESPNEGGRLAEI
HAEQLRCTKRIFYGESTVSRLLPGFSMMLSGYFRKELSDKKYLITSISHAGSDPTLFALGLAKSGDSATV
YSNSFTAIPADTQYRPEMLTSRPQIHGNLDAMIDAEGNGYYAELDNEGRYKVILPFDRQLRDEGKASHWI
RMSQILAGDDEGAHFPLRKGSHVLLSFIGGDPDRPIITGAMPNASAPSVVSENNQTQSRIKTRAGNFIEI
EDQDEKRRIKLFSPHKNTYMHLGAHNAPGDGIIKISEGISRQEFGGGSQHTFVTSSKLREYQSSTSNDHN
LFNEQELFKFPKRGEDGSGSGTIPESDEIKGLYHVLRRIGDYHQWTEGNEFYYGGGNVFNFGANYEETHA
NEDGIEKGEEIFTDYETAPKGAKGYDLENTHISKVWGNQIEYSNGDVYSWGDGNEYSFGGGYAESHVYTE
KYLDLNKKWSDEHDVYDPSDKAAKTISTADGKVTLTIEDADIEKSFGDSYEFEIGNSIEITKGNSEEHKY
GDSYEFVHGGRHEETVFVGTTRASHSVENGSVSEEWTYHPTTGAFLAYSRSDQGGLLNFEYNAAPSMSMT
IETATPRVEITAELAKIEIASGLNATAISAYASEIELNFAGFKLESLAAGILMEVKSAGINAEGTHINTT
AADIQSQITTVKQSNAAIHTASAKIQNAGLSLASGVLSIFS
 
Nucleotide Sequence: 2856 bp     [Download]
>gi|304309652|ref|NC_014366.1|:c1524319-1521464 Gamma proteobacterium HdN1 chromosome, complete genome
ATGGGGCGCTTTTCCATGGTGGATGCCGTTCAGTTTTCGTTTACGAGCCAGTCGCTTCCTCAATATAAGT
TCATTGTAAATCGGTTTCAGGGTGATGAGGGATTATCGCAGCTATACCATTTCGAAATTGAGCTGAGGAC
CCGCAACACGGACATTGATCTAGACCAAGTATTGCAAGCTAGCTGGCAGCTCGCAATCACTACCCATGGT
CAGAAGCGCTTGATCAATGGCATTGTTTCCGAATGCGAGATGTTGCGCCACGTCGAAGGGTTTGACCTCT
ACCGCGCTTGCCTTGTCCCACATATTTGGCAGTTGGGGCAGTACCATGCAAATGAAGTATATCTGGATAA
AACAGTCCCCGATATTTTGCGTGCAGTGCTAGGTGAAGCCAATTTTAGCTCTATGGATTATGAGCTACAT
TTGAACGAGGGAAGTTATCGAAAATGGCCCTATCGCTGCCAGTACGATGAGACGCATCTGGATTTCATTA
AACGCCTGATGGAGCGTGAAGGGATCTACTTCTGGTTTACTCAAAAGGCGGACGGCGAGAAGCTGATCAT
TGCGGACAGTCTGCAAACCCATGAAGATATGCCGTCGCCAAACGTGAAATATGATCCATCTAGCGGGCTG
GAAGGCGAGCATTTCGAGAACAGCGTCCAATCGCTTGTTTGCCGCCAGAAGCGCCTACCTCAACTTCTTA
CATTACGCGATTATAATGACAACAAGCCTTCGGTCGATATTAAGGGCGAATGCAATGTGGATCCCAATGG
CGTGGGTGAAATCAATCTATTCGGGCTGAACATCGAGTCTCCCAATGAAGGCGGCCGCCTTGCGGAAATT
CATGCGGAGCAACTGCGCTGCACAAAGCGGATATTTTACGGAGAGAGTACAGTATCGCGGCTTTTGCCGG
GCTTTTCAATGATGCTATCCGGCTACTTTAGGAAAGAGTTGAGTGATAAAAAATATTTAATCACGTCAAT
TTCTCATGCGGGCTCGGATCCAACGCTTTTTGCGCTCGGCTTAGCCAAAAGTGGCGATAGCGCGACGGTA
TATTCTAACAGTTTTACTGCGATTCCTGCCGACACCCAATACCGGCCAGAAATGCTGACGTCGCGCCCTC
AAATCCACGGCAACCTGGACGCCATGATTGATGCGGAAGGGAATGGGTATTACGCAGAGCTAGATAACGA
AGGCCGTTATAAAGTCATACTGCCCTTTGATCGACAACTACGTGATGAAGGGAAGGCATCCCATTGGATT
CGAATGAGCCAGATTCTTGCGGGTGACGATGAGGGTGCGCATTTTCCGCTGCGCAAGGGCTCTCATGTGC
TGCTGAGTTTTATCGGCGGCGACCCAGATCGGCCGATCATTACTGGCGCTATGCCCAATGCCTCTGCACC
GAGTGTGGTTTCAGAAAATAATCAGACGCAAAGTCGAATCAAGACGCGGGCTGGAAATTTTATCGAGATC
GAAGATCAGGATGAGAAGCGAAGGATTAAGTTGTTTTCGCCACACAAAAACACATACATGCACCTAGGCG
CTCACAATGCGCCCGGGGATGGAATTATAAAAATTTCTGAGGGAATCAGTCGACAGGAGTTTGGCGGTGG
ATCTCAACACACCTTTGTCACAAGCTCCAAGCTTCGCGAATACCAGTCTAGCACAAGCAATGACCACAAT
CTGTTTAATGAGCAGGAGCTATTCAAGTTTCCAAAGCGCGGAGAGGACGGAAGTGGGTCTGGAACCATTC
CCGAGAGCGACGAGATCAAGGGGCTTTATCACGTATTACGCCGTATTGGAGATTATCACCAGTGGACGGA
GGGGAACGAATTTTACTACGGCGGCGGTAATGTTTTTAACTTCGGCGCGAACTACGAGGAAACGCATGCT
AATGAGGATGGAATCGAAAAAGGCGAGGAGATTTTTACCGACTACGAGACGGCTCCAAAGGGTGCGAAGG
GTTACGATCTAGAGAATACCCATATTTCGAAAGTATGGGGAAATCAGATTGAATATTCCAATGGGGATGT
ATATTCGTGGGGTGACGGGAATGAATATTCCTTTGGAGGAGGATACGCAGAAAGCCATGTCTACACGGAA
AAGTATCTGGATCTAAACAAAAAGTGGTCGGATGAACACGACGTGTATGACCCTTCGGACAAAGCCGCAA
AGACCATTTCCACCGCCGATGGAAAAGTTACGTTAACGATTGAAGACGCAGACATCGAAAAATCGTTTGG
TGATTCTTATGAGTTCGAAATAGGCAACTCCATTGAGATCACCAAGGGAAATTCAGAAGAACACAAATAT
GGTGACAGCTATGAGTTTGTGCATGGCGGCCGGCATGAGGAGACCGTATTTGTAGGTACGACACGTGCAT
CCCATTCCGTTGAAAACGGTTCCGTTTCTGAAGAATGGACATATCATCCTACCACCGGCGCCTTTTTAGC
ATATAGCCGGTCAGACCAAGGTGGGTTATTGAATTTTGAGTACAACGCAGCGCCGTCGATGTCGATGACG
ATTGAAACGGCCACACCAAGGGTTGAAATCACCGCCGAGCTTGCAAAAATTGAAATCGCATCTGGCCTAA
ATGCGACCGCAATATCCGCCTATGCATCAGAAATTGAGCTGAATTTTGCCGGATTCAAACTTGAATCACT
AGCCGCAGGAATTTTGATGGAAGTAAAATCTGCGGGGATTAACGCGGAAGGTACACATATAAATACTACG
GCAGCTGACATTCAAAGCCAGATAACCACTGTCAAACAAAGCAACGCTGCAATCCACACGGCATCGGCTA
AAATTCAGAACGCTGGGCTCAGCCTCGCCAGCGGCGTACTTTCGATTTTTTCATAA