SecReT6
Protein ID: 307130218
SecReT6 ID409
T6SS typei1
Gene symbol-
Locus tagDda3937_00817
StrainDickeya dadantii 3937
Repliconchromosome [GenBank: NC_014500] [Browse all T6SS(s) in this replicon]
Location [Strand]1574284..1574787 [+]
Productprotein ImpB
NoteTssB
UniProt IDE0SGM8
KEGG IDddd:Dda3937_00817
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.90E-58, Aligned region: 9..161
Protein Sequence: 167 a.a.     [Download]
>gi|307130218|ref|YP_003882234.1| unnamed protein product [Dickeya dadantii 3937]
MAKGTDGASVAPKERINIKYVPATGGQQAEIELPLTLMVVGNMKGRTEETPIEERQTVSIDKNNFTSVMK
EANLELNFSVPNRLEEDSQDDLPVKLSIASLNDFSPDRIAQQVPELRKLLELREALVALKGPLGNIPAFR
NRLQDLLSSEEARAQLLKELDLVKPAE
 
Nucleotide Sequence: 504 bp     [Download]
>gi|307128764|ref|NC_014500.1|:1574284-1574787 Dickeya dadantii 3937 chromosome, complete genome
ATGGCAAAAGGAACTGACGGTGCATCTGTCGCACCAAAGGAACGTATTAATATCAAATATGTCCCGGCCA
CTGGTGGTCAGCAGGCGGAAATTGAACTGCCGCTTACGCTGATGGTGGTGGGAAATATGAAAGGACGCAC
AGAAGAAACGCCGATTGAAGAACGTCAAACGGTGTCTATCGACAAGAACAACTTCACTTCGGTGATGAAA
GAGGCCAACCTGGAGCTGAATTTCAGCGTACCTAACCGTCTGGAAGAAGACAGCCAGGATGACCTTCCCG
TCAAACTCAGCATCGCTTCGCTGAATGATTTCTCCCCCGATCGCATCGCCCAGCAAGTGCCGGAACTGCG
CAAACTGTTGGAACTGCGTGAAGCCCTGGTCGCGCTGAAAGGGCCGTTGGGTAATATTCCCGCTTTCCGT
AATCGCCTGCAGGATCTGTTGTCCAGCGAAGAGGCCAGAGCGCAGCTGCTCAAAGAGCTGGATCTGGTGA
AACCCGCCGAATAA