SecReT6
Protein ID: 307130219
SecReT6 ID409
T6SS typei1
Gene symbol-
Locus tagDda3937_00816
StrainDickeya dadantii 3937
Repliconchromosome [GenBank: NC_014500] [Browse all T6SS(s) in this replicon]
Location [Strand]1574819..1576297 [+]
ProductSciI protein
NoteTssC
UniProt IDE0SGM9
KEGG IDddd:Dda3937_00816
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.90E-186, Aligned region: 65..490
Protein Sequence: 492 a.a.     [Download]
>gi|307130219|ref|YP_003882235.1| unnamed protein product [Dickeya dadantii 3937]
MSMVEEQAQTGAAGGSSSLLEEIMAQARITPVDEGYNVAKQGIAALVANILDSGNAAEPVNKALVDSMIV
ELDKKLSKQIDVILHAQELQELESSWRSLKLLIDRTDFRENIKILLLHATKNELLEDFEFAPEITQSGFY
KHVYSSGYGQFGGQPIGGVIGDYALTQSSPDIKLMQYVSAVGAMAHAPFVSSVAPTFFGVDSFTDLPSIK
DLKSVFEGPAYTKWRSMRESEDARYLGLTAPRFLARLPYDPVENPIKGFNYKEDISANHEHYLWGNTAYL
MGTAITDSFAKYRWCPNIIGPQSGGAITDLPVHVYEAMGQLQAKIPTEVLITDRREYEMAEEGFITLTMR
KDSDNAAFFSANSVQKPKVFANTKEGKEAETNYKLGTQLPYMFIINRLAHYIKVLQREQIGSWKERQDLE
RELNNWIKQYVADQENPPADVRSRRPLRAAQIKVLDVEGEPGWYQVTMAVRPHFKYMGANFELSLVGRLD
KE
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|307128764|ref|NC_014500.1|:1574819-1576297 Dickeya dadantii 3937 chromosome, complete genome
ATGTCAATGGTTGAAGAACAGGCCCAGACAGGCGCGGCCGGTGGTTCATCGTCGCTGCTTGAAGAAATCA
TGGCGCAGGCGCGCATCACCCCGGTGGATGAAGGTTATAACGTCGCCAAGCAAGGGATCGCCGCGCTGGT
GGCCAACATTCTGGACAGCGGTAACGCGGCCGAGCCGGTGAACAAGGCGCTGGTCGACAGCATGATCGTT
GAGCTGGACAAGAAACTCAGCAAGCAGATCGACGTGATTCTGCATGCGCAGGAACTGCAGGAGCTGGAAT
CCTCCTGGCGTTCGCTGAAACTGCTGATCGATCGCACCGATTTCCGCGAAAACATCAAAATCCTGCTGCT
GCACGCCACCAAAAACGAGCTGCTGGAGGACTTTGAGTTCGCACCGGAAATCACCCAGTCCGGTTTCTAC
AAACACGTTTATTCCAGCGGCTACGGCCAGTTCGGCGGCCAGCCGATCGGCGGGGTGATCGGCGATTACG
CGCTGACCCAGAGTTCGCCGGACATCAAGCTGATGCAGTATGTCAGCGCGGTGGGCGCCATGGCGCACGC
GCCGTTCGTCTCCTCCGTCGCACCGACCTTCTTCGGCGTGGACAGCTTTACCGATCTGCCGTCCATCAAA
GACCTGAAATCGGTGTTTGAAGGCCCGGCCTACACTAAATGGCGTTCGATGCGCGAGTCGGAAGATGCCC
GTTATCTGGGCCTGACGGCGCCGCGTTTCCTGGCTCGTCTGCCTTATGATCCGGTAGAAAACCCGATCAA
AGGGTTTAATTACAAGGAAGACATCAGCGCCAACCACGAACACTATCTGTGGGGCAACACCGCTTATCTG
ATGGGTACCGCCATCACCGACAGCTTCGCCAAGTACCGCTGGTGCCCGAACATTATCGGCCCGCAGAGCG
GCGGCGCCATCACCGATTTGCCGGTGCATGTCTATGAAGCGATGGGCCAGTTGCAGGCCAAGATTCCGAC
CGAGGTGTTGATCACCGACCGCCGCGAATACGAAATGGCCGAAGAGGGTTTCATCACCCTGACCATGCGT
AAAGACAGCGACAACGCCGCGTTCTTCTCCGCCAACTCGGTGCAGAAACCCAAGGTATTCGCCAACACCA
AAGAAGGTAAAGAGGCGGAAACCAACTACAAACTGGGTACGCAGCTGCCGTACATGTTCATCATCAACCG
TCTGGCGCACTACATCAAAGTATTGCAGCGCGAGCAGATCGGTTCCTGGAAAGAGCGTCAGGATCTGGAG
CGCGAGCTGAATAACTGGATCAAGCAGTACGTCGCCGATCAGGAAAACCCGCCGGCAGACGTACGTAGCC
GTCGCCCGCTGCGCGCCGCCCAGATCAAGGTGCTGGACGTAGAAGGCGAACCGGGCTGGTATCAGGTGAC
CATGGCCGTGCGCCCGCACTTCAAATACATGGGGGCGAACTTTGAACTGTCCCTGGTTGGGCGTCTGGAT
AAGGAATAA