SecReT6
Protein ID: 307130220
SecReT6 ID409
T6SS typei1
Gene symbol-
Locus tagDda3937_00815
StrainDickeya dadantii 3937
Repliconchromosome [GenBank: NC_014500] [Browse all T6SS(s) in this replicon]
Location [Strand]1576304..1576735 [+]
Producthypothetical protein
NoteTssE
UniProt IDE0SGN0
KEGG IDddd:Dda3937_00815
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.00E-20, Aligned region: 31..123
Protein Sequence: 143 a.a.     [Download]
>gi|307130220|ref|YP_003882236.1| unnamed protein product [Dickeya dadantii 3937]
MPSLSAWERGSAASLFDRIRGEERRSSPETELEDLIESVKRQLDQVLNTRPGSCRSAPELGVIDFNDATQ
GGADIRGKIREAIRQCICRFEPRIVHVDVSASDYLSNPLEMSFQVTAHVRLEDLEQVTSFNIHMDSHRHY
RMM
 
Nucleotide Sequence: 432 bp     [Download]
>gi|307128764|ref|NC_014500.1|:1576304-1576735 Dickeya dadantii 3937 chromosome, complete genome
ATGCCGTCGCTCTCTGCCTGGGAGCGGGGATCTGCGGCCAGCCTGTTTGATCGTATCCGGGGAGAGGAGC
GCCGTTCCTCTCCCGAAACGGAGTTGGAAGACCTGATCGAGTCGGTGAAACGCCAGCTCGATCAGGTACT
GAATACGCGCCCCGGCAGTTGTCGCAGCGCACCCGAGCTTGGCGTGATTGATTTCAATGACGCCACGCAG
GGCGGCGCGGATATTCGGGGCAAGATCCGTGAAGCGATCCGACAGTGTATCTGCCGCTTTGAACCGCGAA
TTGTCCATGTGGACGTCAGTGCATCGGACTATCTGTCCAATCCGCTGGAGATGTCGTTTCAGGTCACCGC
GCATGTGCGGCTGGAAGACCTGGAGCAGGTCACCTCCTTCAATATTCATATGGACAGCCACCGCCATTAC
AGAATGATGTGA