SecReT6
Protein ID: 307130221
SecReT6 ID409
T6SS typei1
Gene symbol-
Locus tagDda3937_00814
StrainDickeya dadantii 3937
Repliconchromosome [GenBank: NC_014500] [Browse all T6SS(s) in this replicon]
Location [Strand]1576738..1578504 [+]
Producthypothetical protein
NoteTssF
UniProt IDE0SGN1
KEGG IDddd:Dda3937_00814
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 8.10E-199, Aligned region: 3..587
Protein Sequence: 588 a.a.     [Download]
>gi|307130221|ref|YP_003882237.1| unnamed protein product [Dickeya dadantii 3937]
MSLEHFFRDELAYLRLQGREFAKAYPELTRFLSEQTTDPDVERLLEGFAFLTGSLRAKIEDEFPELTHGL
LGMLWPNYLRPVPSMTIMQFSVLPGAIAQPAFVSRGCELDSLPIDDVVCHFQTCHDAWIYPADIRQINAQ
SGNDMSAITLDIGLHGPLSLGDLQLDKLRFFLGGDRYTAYELYFWIASQLSHIELEIDGKRFRQEANVLK
TVGFEREDAMLPYPGNVYSGYRILQEYFCFPESFLFFQLSGASWPNQPLMVTDFKLHFCFDRPLPAELKI
RPDSFMLNCVPAINLFRHDSEPINLDGRQTDYPLKASYRHADSFEIFSIDKVEGWVEGNSGRSRGIPRLY
QPFESFQHQIERAKGRLALYYRIRVREAVSGDGFDHLLSFVRGDEKEVIDLDESISVSLTCTNRSRAAQL
PVGAICVPTGSSPSFATFRNLIRPSRPLRPALDGSLHWTLISNLSLNYVSLLRRDALVQILRTYDFPALH
DKQAEQASRKRLAGIETIETTPVDRLVQGMPVRGLKSVLSVRQSAFSSEGELYLFSTVLAHFFSLYASVN
AFHLLEVVNIDNKERYRWPVQIGQHSMM
 
Nucleotide Sequence: 1767 bp     [Download]
>gi|307128764|ref|NC_014500.1|:1576738-1578504 Dickeya dadantii 3937 chromosome, complete genome
ATGTCGCTGGAACATTTCTTCAGGGATGAGCTGGCCTATTTGCGCCTGCAGGGGCGCGAATTCGCCAAGG
CATACCCTGAACTTACCCGATTTTTGTCAGAACAGACCACGGATCCGGATGTCGAGCGGTTGCTGGAGGG
TTTTGCCTTTCTGACCGGCAGCCTGCGGGCGAAGATCGAGGATGAGTTTCCGGAGCTGACGCACGGCCTG
CTGGGCATGCTGTGGCCGAACTATTTGCGCCCGGTGCCCAGCATGACCATCATGCAGTTTTCGGTACTGC
CCGGCGCCATCGCGCAACCGGCATTCGTGTCGCGCGGCTGCGAGCTGGACAGCCTGCCGATCGACGATGT
GGTGTGCCATTTTCAGACCTGCCACGATGCCTGGATCTACCCGGCGGATATCCGCCAGATCAACGCGCAA
AGCGGCAACGACATGTCCGCCATCACGCTGGATATCGGCCTGCACGGGCCATTGTCGCTGGGGGATCTGC
AGCTCGATAAACTGCGTTTCTTCCTGGGCGGCGACCGCTATACCGCCTATGAACTCTATTTCTGGATAGC
AAGCCAGTTATCGCACATTGAGCTGGAAATTGACGGTAAACGCTTTCGTCAGGAAGCGAATGTGCTGAAA
ACCGTCGGCTTCGAGCGTGAAGACGCGATGCTGCCGTATCCCGGCAACGTCTACTCCGGCTACCGCATCC
TGCAGGAGTACTTCTGCTTTCCGGAAAGTTTTCTGTTCTTCCAGTTGTCCGGCGCCAGTTGGCCTAACCA
GCCGCTGATGGTGACGGATTTCAAACTGCACTTCTGTTTTGACCGGCCGTTGCCGGCGGAACTGAAAATC
CGCCCGGATTCGTTCATGCTTAACTGCGTGCCGGCCATCAACCTGTTCCGTCATGACAGCGAACCTATCA
ACCTGGACGGCCGCCAGACCGATTACCCGCTCAAGGCCAGCTATCGCCACGCCGACAGTTTCGAAATTTT
CTCCATCGACAAGGTCGAAGGCTGGGTGGAAGGCAACAGCGGACGCTCGCGCGGCATTCCGCGGCTCTAT
CAGCCTTTCGAAAGTTTCCAGCATCAAATCGAGCGGGCCAAAGGGCGGCTGGCGCTGTATTACCGCATCC
GGGTGCGTGAAGCGGTCAGCGGCGACGGTTTCGATCACCTGCTGTCGTTTGTGCGCGGCGACGAGAAAGA
GGTGATCGATCTTGATGAATCCATTTCGGTCAGCCTGACCTGCACCAACCGTTCGCGGGCGGCGCAGTTG
CCGGTGGGCGCTATCTGCGTGCCGACCGGCAGTTCGCCGTCTTTCGCCACTTTCCGCAACCTGATTCGAC
CGAGCCGTCCGCTGCGGCCGGCGCTCGACGGCAGCCTGCACTGGACGCTGATCTCCAACCTGTCGCTAAA
CTATGTGTCGCTGCTGCGCCGCGATGCGCTGGTGCAGATTCTGCGTACCTACGACTTCCCGGCGTTGCAT
GACAAGCAGGCGGAGCAGGCGTCGCGCAAGCGGCTGGCGGGGATCGAGACGATTGAAACCACGCCGGTGG
ACCGGCTGGTGCAGGGGATGCCGGTGCGTGGGCTCAAGTCGGTCTTGTCGGTGCGGCAGTCGGCGTTCTC
CAGTGAAGGCGAACTCTATCTGTTCAGCACCGTGCTGGCGCATTTCTTTTCGTTGTACGCCAGCGTCAAC
GCCTTCCATCTGCTGGAAGTGGTCAACATCGATAACAAGGAGCGCTACCGATGGCCGGTGCAGATAGGTC
AGCACTCAATGATGTAA