SecReT6
Protein ID: 307130222
SecReT6 ID409
T6SS typei1
Gene symbol-
Locus tagDda3937_00813
StrainDickeya dadantii 3937
Repliconchromosome [GenBank: NC_014500] [Browse all T6SS(s) in this replicon]
Location [Strand]1578468..1579481 [+]
ProductSciB protein
NoteTssG
UniProt IDE0SGN2
KEGG IDddd:Dda3937_00813
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.20E-94, Aligned region: 21..324
Protein Sequence: 337 a.a.     [Download]
>gi|307130222|ref|YP_003882238.1| unnamed protein product [Dickeya dadantii 3937]
MAGADRSALNDVMPDQAMFRQDARHFNFFQLVELLNQMEGVDLEQALDFRPELERIRFRSTASIGFHPSD
VLRVGEDVDGRQELEVAFLGLHGSQSPMPGYYLEELAWEYAQGEQKLGVFLDFFHHRLLTLLHRAWRKYR
YHVRFQNDGEDGFSRLMFALVGLGNDAVRDSLPVNRAKMLSYAGLLASPSRSPEVVAGLVIHCFDLEDVE
VIAWQHRKVPIFEDQQNRLGRANSVLGGDFVIGDKVNDCAGKFLLKVDNLSFGRFLSFLPNGEHFQPLVR
FVSFILRDQLAWDLRLGFAEGEARGLRLGDDQSSRLGWSSFLGQPPADPYVTICVQE
 
Nucleotide Sequence: 1014 bp     [Download]
>gi|307128764|ref|NC_014500.1|:1578468-1579481 Dickeya dadantii 3937 chromosome, complete genome
ATGGCCGGTGCAGATAGGTCAGCACTCAATGATGTAATGCCCGATCAGGCGATGTTTCGCCAGGACGCGC
GCCACTTCAACTTTTTCCAACTGGTGGAGTTGCTCAACCAGATGGAAGGCGTCGATCTGGAGCAGGCGCT
CGATTTCCGGCCGGAGCTGGAGCGCATTCGCTTTCGCTCTACCGCGTCGATTGGCTTTCACCCCAGCGAT
GTGCTGCGGGTGGGTGAGGATGTCGACGGCCGACAGGAACTTGAAGTCGCGTTTCTCGGTCTGCACGGCA
GCCAGTCGCCGATGCCGGGGTATTACCTCGAAGAGCTGGCGTGGGAGTACGCCCAGGGCGAGCAAAAACT
GGGCGTGTTTCTCGATTTTTTCCACCATCGGCTGCTGACGCTGCTGCACCGCGCCTGGCGCAAATACCGC
TACCACGTCCGTTTCCAGAATGACGGCGAAGACGGTTTTTCCCGGCTGATGTTCGCGCTGGTGGGGCTCG
GCAACGACGCGGTGCGCGACAGCCTGCCGGTCAACCGGGCCAAGATGCTGTCTTACGCCGGCCTGCTGGC
CAGCCCCAGCCGCTCGCCGGAAGTGGTGGCCGGTCTGGTTATCCACTGCTTTGACCTTGAAGACGTAGAG
GTCATCGCCTGGCAGCACCGCAAAGTACCGATTTTCGAAGACCAGCAAAACCGGCTGGGGCGCGCCAACA
GCGTGCTGGGCGGGGATTTTGTCATCGGCGACAAGGTGAATGACTGCGCCGGCAAATTCCTGCTCAAAGT
GGATAACCTCAGCTTCGGCCGGTTTCTCAGTTTCCTGCCCAACGGCGAGCATTTTCAGCCGCTGGTGCGT
TTTGTTTCCTTCATTCTGCGCGATCAACTGGCCTGGGACCTGCGCCTCGGTTTCGCCGAAGGAGAGGCCA
GAGGGCTGCGGCTGGGCGATGACCAGAGCAGCCGTCTGGGATGGAGCAGCTTTCTCGGGCAGCCACCCGC
CGACCCGTATGTGACGATTTGTGTGCAGGAGTAA