SecReT6
Protein ID: 307130223
SecReT6 ID409
T6SS typei1
Gene symbol-
Locus tagDda3937_00812
StrainDickeya dadantii 3937
Repliconchromosome [GenBank: NC_014500] [Browse all T6SS(s) in this replicon]
Location [Strand]1579418..1580698 [+]
Producthypothetical protein
NoteFha
UniProt IDE0SGN3
KEGG IDddd:Dda3937_00812
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 4.60E-06, Aligned region: 55..122
Protein Sequence: 426 a.a.     [Download]
>gi|307130223|ref|YP_003882239.1| unnamed protein product [Dickeya dadantii 3937]
MEQLSRAATRRPVCDDLCAGVIVNENNPLTLVVLNSEQLDINSQVQHRFDHRGGTLGASEKDQWQLRDRL
GAVLPEHARIELQDGHFCVCDLSGQTFINGALSPIGRDRRVSLEHGDELVIGPFRLGVYLEDPAREQDID
QVLGQRPGDVLEGWLDEERHSPTVEETTASRFNDPLWALQQEQSRSPLATEGERGDELPASLSSFSAVED
TMDQKFVELPTIDSPHAGAGLGGQVDAVTLAPLLRGLGVSLNTGDEQQLRDMLEEMGRSLKAMVEGLLTL
QADQAALADTHLRPIEDNPLRLGLDYTDTLSLLFADDKSPVHLSAPAAVSEVLSNMQAHHRANQQAIAVA
LESILQAFSPAALLGRFEHYRRSGERQALDDGWAWQMYQHYYRELTSPRQQGFQKLFHQVYAQAYDRAVR
QQQEQK
 
Nucleotide Sequence: 1281 bp     [Download]
>gi|307128764|ref|NC_014500.1|:1579418-1580698 Dickeya dadantii 3937 chromosome, complete genome
ATGGAGCAGCTTTCTCGGGCAGCCACCCGCCGACCCGTATGTGACGATTTGTGTGCAGGAGTAATTGTGA
ACGAAAACAACCCACTTACGCTGGTGGTGCTCAACAGCGAACAGCTGGATATCAATTCGCAGGTGCAGCA
CCGGTTTGATCACCGCGGCGGCACGCTGGGCGCGTCGGAAAAGGATCAGTGGCAACTGCGTGACCGGCTG
GGAGCGGTATTGCCGGAACATGCGCGCATCGAATTACAAGACGGCCATTTCTGCGTGTGCGACCTGAGCG
GCCAGACCTTCATCAACGGCGCGCTGTCACCCATCGGCCGTGACCGCCGGGTGAGTCTGGAGCACGGCGA
CGAACTGGTGATCGGTCCGTTCCGGCTGGGGGTCTACCTTGAGGATCCGGCGCGCGAGCAGGACATCGAT
CAGGTGCTGGGTCAGCGCCCCGGCGACGTGCTGGAAGGGTGGCTTGACGAAGAACGACACAGCCCGACCG
TCGAAGAGACGACGGCGAGCCGATTTAATGACCCGTTGTGGGCGTTGCAGCAGGAACAGAGCCGCTCGCC
GCTGGCAACGGAGGGTGAGCGCGGCGACGAACTGCCGGCCTCGCTTTCTTCTTTTTCTGCCGTTGAGGAC
ACCATGGATCAGAAATTTGTGGAATTACCGACCATTGATAGCCCGCACGCCGGAGCGGGTCTGGGCGGGC
AGGTTGACGCAGTGACGCTGGCGCCGCTGCTGCGCGGGCTGGGCGTATCGCTGAATACCGGTGATGAGCA
GCAACTGCGCGACATGCTCGAAGAGATGGGCCGAAGCCTGAAGGCGATGGTGGAAGGTCTGCTGACGTTG
CAGGCCGATCAGGCGGCATTGGCGGATACCCATCTGCGGCCGATCGAAGATAACCCGCTGCGGTTGGGGC
TGGATTACACCGATACCCTGTCGCTGCTGTTCGCCGACGATAAAAGCCCGGTGCACCTGTCCGCGCCCGC
GGCGGTCAGCGAAGTGCTCAGCAATATGCAGGCGCATCATCGGGCCAACCAGCAGGCGATCGCCGTGGCG
CTGGAAAGCATTTTGCAGGCGTTTTCACCGGCGGCGCTGCTGGGCCGTTTCGAACATTATCGCCGCAGCG
GCGAACGTCAGGCGCTCGACGACGGCTGGGCGTGGCAGATGTACCAGCACTATTACCGTGAACTGACCTC
GCCGCGTCAGCAAGGGTTCCAGAAACTGTTCCATCAGGTGTATGCGCAGGCGTATGACCGCGCGGTTCGC
CAGCAACAGGAGCAGAAATAA