SecReT6
Protein ID: 307130224
SecReT6 ID409
T6SS typei1
Gene symbol-
Locus tagDda3937_00811
StrainDickeya dadantii 3937
Repliconchromosome [GenBank: NC_014500] [Browse all T6SS(s) in this replicon]
Location [Strand]1580698..1581234 [+]
Productlipoprotein
NoteTssJ
UniProt IDE0SGN4
KEGG IDddd:Dda3937_00811
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.40E-37, Aligned region: 16..169
Protein Sequence: 178 a.a.     [Download]
>gi|307130224|ref|YP_003882240.1| unnamed protein product [Dickeya dadantii 3937]
MLRALMLRIGWLCALMLLLPGCSTLGKMAKVAANPDIQIGSNDNQPSTVGFSLVAEPDVNPSESGEAAPV
EFQLVMLAEDSRLLATDYDQVTTDIEKALAKNYLSHQDYTLLPGQFKYLPPVKLDEKVHYIGVIAKYADP
DSAEWRKVIKLKNTGRTYQLLVHLRREEVEIKKDQEEE
 
Nucleotide Sequence: 537 bp     [Download]
>gi|307128764|ref|NC_014500.1|:1580698-1581234 Dickeya dadantii 3937 chromosome, complete genome
ATGCTGCGAGCCTTAATGCTGCGAATCGGGTGGTTATGCGCCTTGATGCTGTTGCTTCCCGGTTGCTCCA
CGCTCGGCAAGATGGCGAAGGTGGCGGCTAATCCGGATATTCAGATCGGCAGCAACGATAACCAGCCGTC
CACCGTCGGTTTCAGTCTGGTGGCGGAGCCGGACGTCAACCCCAGCGAGAGCGGCGAAGCCGCGCCAGTT
GAGTTTCAACTGGTGATGCTGGCGGAAGACTCCCGCCTGCTGGCCACCGATTACGACCAGGTAACCACCG
ATATCGAAAAAGCGCTGGCCAAGAATTACCTCAGCCATCAGGACTACACGCTGCTGCCGGGGCAGTTCAA
ATACCTGCCGCCGGTCAAGCTGGATGAAAAAGTGCATTACATCGGGGTGATCGCCAAGTACGCCGACCCG
GACAGCGCCGAGTGGCGCAAGGTGATCAAGCTGAAAAATACCGGCCGCACTTATCAGCTTCTGGTGCATC
TGCGCCGTGAAGAAGTCGAAATCAAGAAAGATCAAGAAGAAGAATAA