SecReT6
Protein ID: 307130225
SecReT6 ID409
T6SS typei1
Gene symbol-
Locus tagDda3937_00810
StrainDickeya dadantii 3937
Repliconchromosome [GenBank: NC_014500] [Browse all T6SS(s) in this replicon]
Location [Strand]1581237..1582574 [+]
Productprotein ImpJ
NoteTssK
UniProt IDE0SGN5
KEGG IDddd:Dda3937_00810
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.80E-157, Aligned region: 19..443
Protein Sequence: 445 a.a.     [Download]
>gi|307130225|ref|YP_003882241.1| unnamed protein product [Dickeya dadantii 3937]
MSSRNRIIWREGLFIKPQHFQQQQRHTDYALHARLSALSDYFYGLQSLAINEEYLNFGRIALVNATGVMP
DGTVFNIPGDDALPQPLEITDVALANQKVYLALPLAVNGVSEVGQTGAGIATRLQSHRHDVRDLHSEGGD
VVSMEVGKVSLRLMLERDDRSAYASLAIANILDKRPDGGLVLDPNFMPCSISVTAIPSLKRFLGESAGLV
AERARSLAQRIAAPGQQGVADVAEFMMLQLLNRAQPQLSHLARLGTLHPERLHEALVQLCGELMTFTDES
RLPPEFAAYRHEHQQSSFEPLMMALRQALSTVLSPRAVSIQMKAQPYGVRVALVGDAELMAGAEFVLAVR
ARMPQEHLRKQLLQQTKIASSDKIRELISLQLPGVPLLPLPVAPRQLPYHAGYSYFQLDRQSPAWKSLVT
SNTLAFHIAGEFPELDMQLWAIRGQ
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|307128764|ref|NC_014500.1|:1581237-1582574 Dickeya dadantii 3937 chromosome, complete genome
ATGTCGAGCCGAAATCGGATTATTTGGCGGGAAGGGCTGTTCATCAAGCCACAGCATTTCCAGCAACAGC
AAAGACACACGGACTACGCGCTGCATGCCCGTCTTAGCGCGCTCAGTGATTATTTTTACGGCCTGCAATC
ACTGGCGATCAACGAGGAATACCTCAACTTCGGGCGTATCGCACTGGTGAACGCCACCGGCGTGATGCCG
GACGGCACGGTATTCAACATTCCGGGGGATGACGCGCTGCCGCAACCGCTGGAGATCACCGATGTGGCGC
TGGCTAACCAGAAAGTGTATCTGGCGCTGCCGCTGGCGGTGAACGGCGTCAGCGAAGTGGGGCAGACGGG
CGCCGGCATCGCCACCCGCCTGCAGTCGCATCGACACGATGTGCGCGATTTGCACAGCGAAGGCGGCGAC
GTGGTGTCGATGGAAGTGGGCAAGGTCAGCCTGCGGCTGATGCTGGAGCGTGATGACCGCAGCGCCTACG
CCTCGCTGGCGATAGCCAACATCCTCGACAAGCGGCCGGACGGCGGTCTGGTGCTGGACCCCAATTTCAT
GCCGTGCAGCATCAGCGTCACCGCCATTCCGAGCCTGAAACGCTTTCTGGGCGAGTCCGCCGGTCTGGTG
GCGGAACGCGCCCGCAGCCTGGCCCAGCGTATCGCCGCACCCGGTCAGCAAGGGGTGGCGGACGTGGCGG
AGTTCATGATGCTGCAACTGCTTAACCGCGCTCAGCCGCAGCTGTCGCATCTGGCGCGCCTCGGTACGTT
GCACCCGGAGCGGCTGCACGAAGCGCTGGTGCAACTGTGCGGCGAACTGATGACCTTTACCGACGAATCG
CGCCTGCCGCCGGAGTTTGCCGCTTACCGCCACGAGCATCAGCAATCCAGCTTCGAGCCGCTGATGATGG
CGCTGCGTCAGGCGCTGAGCACCGTGCTGTCGCCGCGCGCGGTGTCGATTCAGATGAAGGCGCAGCCTTA
CGGCGTGCGGGTGGCGCTGGTGGGCGACGCCGAACTGATGGCCGGCGCCGAATTTGTGCTGGCGGTGCGC
GCCCGTATGCCGCAGGAGCATCTGCGCAAACAGCTGTTGCAGCAAACCAAGATCGCTTCCAGCGACAAAA
TCCGCGAACTCATCAGCCTGCAACTGCCCGGCGTGCCGCTGCTGCCGTTGCCGGTGGCGCCGCGTCAGCT
GCCGTATCACGCCGGCTACAGCTACTTCCAGTTGGACAGGCAAAGCCCGGCCTGGAAATCGCTGGTCACC
AGCAACACGCTGGCGTTCCACATCGCCGGCGAATTCCCGGAACTGGACATGCAACTGTGGGCTATCCGCG
GCCAGTAG