SecReT6
Protein ID: 307130226
SecReT6 ID409
T6SS typei1
Gene symbol-
Locus tagDda3937_00809
StrainDickeya dadantii 3937
Repliconchromosome [GenBank: NC_014500] [Browse all T6SS(s) in this replicon]
Location [Strand]1582591..1583367 [+]
Productchemotaxis motB protein
NoteTssL
UniProt IDE0SGN6
KEGG IDddd:Dda3937_00809
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.30E-71, Aligned region: 38..242
Protein Sequence: 258 a.a.     [Download]
>gi|307130226|ref|YP_003882242.1| unnamed protein product [Dickeya dadantii 3937]
MSTDIIKSDQLGDLLYDNARQLDMDSDYWFRLRGQSINPMIDAVTPLLGMVERVRQLSEYDGVAELYQRV
QSEIQAIEQELHSHGYENGVILSFRYILCTFIDEAVMGREWGGQSVWSAHSLLTRFHNETWGGEKVFVLL
EKLLDDPVRYRDILEFIYLCLCLGFEGRYRVMTQGREELDRVVRRLHDTLRPEPENTPTVFHLNLGQQSS
RYQLRKQISLRTLFIGLCVVMAAAFGLYHYQLTNQTQDVLRQLGELLQ
 
Nucleotide Sequence: 777 bp     [Download]
>gi|307128764|ref|NC_014500.1|:1582591-1583367 Dickeya dadantii 3937 chromosome, complete genome
GTGAGTACTGACATCATCAAAAGCGATCAGTTGGGCGACCTGCTGTATGACAACGCCCGGCAACTGGATA
TGGATTCCGATTACTGGTTTCGCCTGCGCGGGCAGAGCATCAACCCGATGATCGACGCCGTTACCCCGCT
GCTGGGCATGGTGGAGCGTGTGCGTCAGCTGTCGGAATACGACGGCGTGGCGGAGCTATACCAGCGCGTG
CAGTCCGAAATTCAGGCTATCGAGCAGGAACTGCATTCCCACGGTTACGAGAACGGCGTGATTCTGTCGT
TCCGCTACATTCTGTGCACCTTTATTGACGAAGCGGTGATGGGGCGAGAGTGGGGCGGCCAGAGCGTGTG
GTCCGCCCATTCGCTGCTTACCCGTTTTCACAATGAAACCTGGGGCGGCGAGAAGGTGTTCGTGCTGCTG
GAGAAGCTGCTGGATGACCCGGTGCGCTACCGCGACATTCTGGAATTTATCTACCTGTGCTTGTGCCTCG
GTTTCGAAGGGCGCTACCGGGTGATGACGCAAGGGCGCGAAGAACTGGATCGGGTGGTGCGCCGTTTGCA
CGACACCCTGCGCCCGGAGCCGGAAAATACGCCGACGGTGTTCCACCTCAATCTGGGGCAGCAGTCTTCC
CGTTACCAACTGCGTAAACAGATTTCGCTGCGCACCCTGTTTATCGGCCTGTGCGTGGTGATGGCCGCGG
CGTTTGGCCTCTATCACTACCAGCTAACCAACCAGACCCAGGACGTGCTGCGTCAGCTGGGAGAATTATT
ACAATAA