SecReT6
Protein ID: 307130227
SecReT6 ID409
T6SS typei1
Gene symbol-
Locus tagDda3937_00808
StrainDickeya dadantii 3937
Repliconchromosome [GenBank: NC_014500] [Browse all T6SS(s) in this replicon]
Location [Strand]1583383..1586001 [+]
ProductClpB protein
NoteTssH
UniProt IDE0SGN7
KEGG IDddd:Dda3937_00808
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.20E-38, Aligned region: 277..326
AAA_2 [PF07724], Evalue: 2.20E-38, Aligned region: 603..770
AAA [PF00004], Evalue: 3.80E-19, Aligned region: 220..332
AAA [PF00004], Evalue: 3.80E-19, Aligned region: 538..579
AAA [PF00004], Evalue: 3.80E-19, Aligned region: 609..727
AAA_5 [PF07728], Evalue: 1.60E-13, Aligned region: 220..240
AAA_5 [PF07728], Evalue: 1.60E-13, Aligned region: 608..726
ClpB_D2-small [PF10431], Evalue: 6.40E-11, Aligned region: 130..165
ClpB_D2-small [PF10431], Evalue: 6.40E-11, Aligned region: 776..849
AAA_16 [PF13191], Evalue: 1.10E-10, Aligned region: 135..160
AAA_16 [PF13191], Evalue: 1.10E-10, Aligned region: 197..237
AAA_16 [PF13191], Evalue: 1.10E-10, Aligned region: 258..298
AAA_16 [PF13191], Evalue: 1.10E-10, Aligned region: 582..647
AAA_16 [PF13191], Evalue: 1.10E-10, Aligned region: 674..702
AAA_22 [PF13401], Evalue: 1.20E-07, Aligned region: 219..310
AAA_22 [PF13401], Evalue: 1.20E-07, Aligned region: 607..626
AAA_22 [PF13401], Evalue: 1.20E-07, Aligned region: 670..702
NACHT [PF05729], Evalue: 1.90E-05, Aligned region: 220..243
NACHT [PF05729], Evalue: 1.90E-05, Aligned region: 279..317
NACHT [PF05729], Evalue: 1.90E-05, Aligned region: 413..450
NACHT [PF05729], Evalue: 1.90E-05, Aligned region: 609..632
AAA_25 [PF13481], Evalue: 0.00011, Aligned region: 220..243
AAA_25 [PF13481], Evalue: 0.00011, Aligned region: 273..306
AAA_25 [PF13481], Evalue: 0.00011, Aligned region: 469..469
AAA_25 [PF13481], Evalue: 0.00011, Aligned region: 603..637
DUF258 [PF03193], Evalue: 0.00012, Aligned region: 185..237
DUF258 [PF03193], Evalue: 0.00012, Aligned region: 609..624
AAA_29 [PF13555], Evalue: 0.00031, Aligned region: 215..237
AAA_29 [PF13555], Evalue: 0.00031, Aligned region: 606..630
Arch_ATPase [PF01637], Evalue: 0.00031, Aligned region: 200..234
Arch_ATPase [PF01637], Evalue: 0.00031, Aligned region: 273..307
Arch_ATPase [PF01637], Evalue: 0.00031, Aligned region: 609..629
Arch_ATPase [PF01637], Evalue: 0.00031, Aligned region: 679..690
AAA_30 [PF13604], Evalue: 0.0005, Aligned region: 220..237
AAA_30 [PF13604], Evalue: 0.0005, Aligned region: 451..503
AAA_30 [PF13604], Evalue: 0.0005, Aligned region: 608..628
AAA_30 [PF13604], Evalue: 0.0005, Aligned region: 657..692
AAA_19 [PF13245], Evalue: 0.00069, Aligned region: 217..241
AAA_19 [PF13245], Evalue: 0.00069, Aligned region: 362..397
AAA_19 [PF13245], Evalue: 0.00069, Aligned region: 531..550
AAA_19 [PF13245], Evalue: 0.00069, Aligned region: 602..626
AAA_19 [PF13245], Evalue: 0.00069, Aligned region: 808..831
AAA_17 [PF13207], Evalue: 0.0026, Aligned region: 220..262
AAA_17 [PF13207], Evalue: 0.0026, Aligned region: 609..643
Zeta_toxin [PF06414], Evalue: 0.0044, Aligned region: 217..237
Zeta_toxin [PF06414], Evalue: 0.0044, Aligned region: 607..648
IstB_IS21 [PF01695], Evalue: 0.0046, Aligned region: 214..242
IstB_IS21 [PF01695], Evalue: 0.0046, Aligned region: 608..619
Sigma54_activat [PF00158], Evalue: 0.0047, Aligned region: 219..234
Sigma54_activat [PF00158], Evalue: 0.0047, Aligned region: 608..706
AAA_10 [PF12846], Evalue: 0.0052, Aligned region: 218..238
AAA_10 [PF12846], Evalue: 0.0052, Aligned region: 281..306
AAA_10 [PF12846], Evalue: 0.0052, Aligned region: 350..453
AAA_10 [PF12846], Evalue: 0.0052, Aligned region: 608..639
Ras [PF00071], Evalue: 0.0079, Aligned region: 220..233
Ras [PF00071], Evalue: 0.0079, Aligned region: 609..650
MobB [PF03205], Evalue: 0.0089, Aligned region: 220..241
MobB [PF03205], Evalue: 0.0089, Aligned region: 608..627
Protein Sequence: 872 a.a.     [Download]
>gi|307130227|ref|YP_003882243.1| unnamed protein product [Dickeya dadantii 3937]
MIRIELPILVERLNPLCRHMMEEAAALCIQHQGAEIRIEHLLLKMLETPLCDVRQILKRAGMEADELAAL
LQPNAADKGFESGYPSFSPLLVEWLQDSWLLASAELQHARLRSGVLLLVLLMTPTRYLSATVTRQLAQIN
RELLRQQFDEWVKDSAETEVIAAAGATPEQAAAATTQLARYTQNVTESARQGKLDPVLCRDHEIDLMIDI
LSRRRKNNPIVVGEAGVGKSALIEGLALRIVAGLVPERLRDVELLTLDLGAMQAGASVKGEFEKRFKGVM
QEVKEAPKPVILFIDEAHTLIGAGNQAGGLDVSNLLKPALARGELRTIAATTWSEYKKYVEKDAALSRRF
QLVKVGEPNVDEATVILRGLRSIYEQSHGVLIDEEALQAAANLSARYISGRQLPDKAIDVLDTACARVAI
NLTTPPRAVSQLQTRLHQQALEIAQLERQGRIGLGDTAERLATLRDASETDAATLAQLEADWQRQKTLVQ
QIVALRTALLADEPAEDFDAAAAAAELTDSERALAELQQPSVLVSPHVDKTQIASVIAEWTGVPLNRISQ
GELDVVTRLPDYLGDSIKGQQLAIAQLHKHLLTARADLRRPGRPLGAFLLVGPSGVGKTETVVQIADLMF
GGRNYLTTINMSEYQEKHTVSRLIGSPPGYVGFGEGGVLTEAIRQKPYSVVLLDEVEKAHPDVLNLFYQA
FDKGELADGEGRVIDCRNVVFFLTSNLGFQTIVNFAERVNFADRQNELLDALYPELAAFFKPALLARMEV
IPYLPLGNDTLVEIVQGKLSRLVTLLQQRFGAEVVVDAAVPEEILRLANRSENGARMLESVIDGALLPPV
SLQLLQRLSAGQPVSRIHFRVEDGQFRSEVEG
 
Nucleotide Sequence: 2619 bp     [Download]
>gi|307128764|ref|NC_014500.1|:1583383-1586001 Dickeya dadantii 3937 chromosome, complete genome
GTGATTCGAATCGAACTGCCGATCCTGGTTGAGCGACTCAACCCGCTGTGCCGCCACATGATGGAAGAGG
CGGCGGCGCTGTGCATTCAGCATCAGGGCGCGGAGATCCGCATTGAGCACCTGCTGCTGAAAATGCTGGA
GACGCCGTTGTGCGACGTGCGCCAGATCCTCAAACGCGCCGGGATGGAGGCCGACGAACTGGCGGCCCTG
TTGCAGCCCAATGCCGCGGACAAAGGGTTTGAGTCGGGCTATCCCTCGTTTTCGCCGCTGCTGGTGGAGT
GGTTGCAGGACAGCTGGCTGCTGGCTTCGGCCGAACTCCAGCACGCCCGTCTGCGCAGCGGCGTGCTGCT
GTTGGTGCTGCTGATGACGCCGACGCGCTATCTGTCGGCCACGGTGACCCGCCAACTGGCGCAGATTAAC
CGTGAACTGCTGCGTCAGCAGTTTGACGAATGGGTGAAAGACTCGGCGGAAACCGAGGTGATTGCCGCCG
CCGGCGCGACGCCGGAGCAGGCGGCCGCAGCCACCACCCAGTTGGCCCGCTATACCCAGAATGTCACCGA
GTCCGCCCGTCAGGGCAAGTTAGACCCGGTGCTGTGCCGCGATCATGAAATCGACCTGATGATCGACATT
CTGTCTCGTCGCCGTAAAAACAACCCGATCGTGGTCGGCGAGGCCGGGGTGGGTAAGAGCGCGCTGATTG
AAGGACTGGCGCTGCGCATCGTCGCCGGGCTGGTGCCGGAGCGGCTGCGCGACGTGGAACTGCTGACGCT
GGATTTGGGCGCGATGCAGGCCGGCGCCTCGGTGAAAGGCGAATTCGAGAAACGCTTCAAAGGGGTGATG
CAGGAAGTCAAAGAGGCGCCGAAACCGGTGATCCTGTTCATCGACGAGGCCCACACCTTAATCGGCGCCG
GCAATCAGGCCGGCGGACTGGACGTGTCCAACCTGCTTAAACCGGCGCTGGCGCGCGGCGAACTGCGTAC
CATCGCCGCCACCACCTGGAGCGAATACAAGAAATACGTGGAAAAAGACGCCGCGCTGTCGCGTCGCTTC
CAACTGGTGAAAGTGGGCGAGCCGAACGTCGACGAAGCCACGGTGATTCTGCGCGGGCTGCGCAGCATTT
ACGAACAATCGCACGGCGTGTTGATCGACGAAGAAGCGTTGCAGGCGGCGGCCAATCTGTCCGCGCGGTA
TATCTCCGGGCGCCAGCTGCCGGACAAAGCGATCGACGTACTGGATACCGCCTGCGCGCGCGTCGCCATC
AACCTGACTACGCCGCCGCGCGCGGTCAGCCAGTTGCAGACCCGGTTGCATCAGCAGGCGCTGGAGATCG
CCCAACTGGAGCGTCAGGGCCGCATCGGTCTTGGCGACACGGCGGAGCGGCTGGCGACGCTGCGTGACGC
CAGCGAGACGGACGCCGCGACGCTGGCGCAGTTGGAAGCCGACTGGCAGCGTCAAAAAACGCTGGTGCAG
CAGATTGTCGCCCTGCGCACGGCGTTGCTGGCCGATGAGCCGGCGGAAGATTTCGATGCCGCCGCCGCGG
CCGCTGAGCTGACCGATAGCGAGCGGGCGCTGGCCGAACTGCAACAACCGTCGGTGCTGGTGTCCCCGCA
TGTGGATAAAACCCAGATAGCGTCGGTGATCGCCGAGTGGACCGGGGTACCGTTGAACCGCATTTCCCAG
GGCGAGCTGGACGTGGTTACCCGCCTGCCGGATTACCTCGGCGACAGCATCAAAGGGCAACAGCTGGCGA
TCGCTCAATTGCACAAGCACCTGCTGACCGCCCGCGCCGACCTGCGCCGTCCCGGCCGCCCGTTGGGCGC
GTTTTTGCTGGTGGGGCCGAGCGGCGTGGGCAAGACCGAAACCGTGGTGCAGATTGCCGATCTGATGTTC
GGCGGCCGTAATTATCTCACCACCATCAACATGTCCGAGTACCAGGAGAAACACACGGTTTCCCGCTTAA
TCGGTTCGCCGCCGGGGTATGTCGGCTTTGGCGAGGGCGGGGTGCTGACCGAGGCCATTCGCCAGAAACC
CTATTCGGTAGTGCTGCTGGATGAAGTGGAAAAAGCCCATCCGGACGTGCTCAACCTGTTCTATCAGGCG
TTCGACAAGGGCGAACTGGCGGACGGCGAAGGGCGGGTGATCGACTGCCGCAACGTGGTGTTCTTCCTGA
CCTCCAACCTGGGGTTCCAGACGATTGTCAATTTTGCGGAGCGCGTCAATTTTGCGGATCGACAGAACGA
ACTGCTGGATGCGCTCTATCCGGAACTGGCGGCGTTCTTCAAGCCGGCGTTGCTGGCGCGTATGGAAGTG
ATTCCTTATCTGCCGCTGGGGAACGACACGCTGGTGGAGATCGTGCAGGGCAAACTGTCCCGTCTGGTGA
CGTTGCTGCAACAGCGCTTTGGCGCCGAGGTGGTTGTCGACGCGGCGGTGCCGGAAGAGATTTTGCGTCT
GGCGAACCGCAGCGAGAACGGCGCGCGCATGCTGGAGTCGGTGATCGACGGCGCGCTGTTGCCGCCGGTG
TCGTTGCAATTGCTGCAACGCCTGTCGGCCGGTCAGCCGGTCAGCCGCATTCATTTCCGGGTGGAAGACG
GCCAGTTCCGGTCCGAGGTGGAGGGCTGA