SecReT6
Protein ID: 307130230
SecReT6 ID409
T6SS typei1
Gene symbol-
Locus tagDda3937_00805
StrainDickeya dadantii 3937
Repliconchromosome [GenBank: NC_014500] [Browse all T6SS(s) in this replicon]
Location [Strand]1588093..1589556 [+]
Producthypothetical protein
NoteTssA
UniProt IDE0SGP0
KEGG IDddd:Dda3937_00805
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.10E-14, Aligned region: 57..117
ImpA-rel_N [PF06812], Evalue: 1.10E-14, Aligned region: 175..189
ImpA-rel_N [PF06812], Evalue: 1.10E-14, Aligned region: 409..420
Protein Sequence: 487 a.a.     [Download]
>gi|307130230|ref|YP_003882246.1| unnamed protein product [Dickeya dadantii 3937]
MPLVGAMNMHAHPWCKRLLTTLPDEALRAAVAADDPLWEQVDTELVKLGSLAHSQVDLNAVAGQCLTLLE
SRTKDMRVLVQLLRCLQHPAKATPFATAIMLLDSWLEAYWTLAFPASPVQKQKLMVQIIRRFEGVLPRVA
ENASGAELSQLHQLAEQLAARWSGLAADKADLTDELAAALQRARQRHQAQEKANQAAEPASGAQGGTSGS
GAAASGGSGSATGTTSAAATVEINSSDDRSWKQTQLNVAALLVERQPEAPVGYRLRRNAVWAGIATPPTT
ARGNKTQLAPVSPDRVDEYQSALGQADLALWNKIEQSLTLAPYWFDGHMLSATVATRLGHSAVAGAIADE
LSAFLARLPELRELAFSDGSPFLSAKCAQWLQSSQPARGGGGQRQDDLAAEAAACCAEQGLGAALSLLDE
RIRRLKEPRERFCAELVLADLLAEEGMKALAAQHYQHLWQESERLGLMQWEPGMVSRLERLGASRRK
 
Nucleotide Sequence: 1464 bp     [Download]
>gi|307128764|ref|NC_014500.1|:1588093-1589556 Dickeya dadantii 3937 chromosome, complete genome
GTGCCGCTGGTAGGAGCGATGAATATGCATGCACACCCCTGGTGTAAACGACTGCTGACGACCCTGCCCG
ACGAGGCGCTGCGGGCGGCGGTGGCGGCGGATGATCCGCTGTGGGAACAGGTGGATACCGAGCTGGTTAA
GCTGGGGTCGCTGGCGCACAGCCAGGTGGATCTCAACGCGGTCGCCGGTCAGTGCCTGACGCTGCTGGAG
AGCCGCACCAAAGACATGCGCGTGCTGGTGCAACTGCTGCGTTGTTTACAGCACCCGGCCAAGGCCACTC
CGTTCGCCACCGCCATCATGCTGCTCGACAGCTGGCTGGAGGCCTACTGGACGCTGGCGTTCCCCGCCAG
TCCGGTACAAAAACAGAAGCTGATGGTGCAGATCATCCGCCGTTTTGAGGGCGTGCTGCCCCGCGTGGCG
GAAAACGCCTCCGGAGCGGAGCTGAGCCAGCTGCATCAACTGGCGGAACAACTGGCGGCGCGCTGGAGCG
GTTTGGCCGCCGACAAGGCTGACCTGACCGACGAACTGGCGGCGGCGCTGCAACGCGCCCGGCAACGTCA
TCAGGCGCAGGAGAAAGCCAATCAGGCGGCGGAGCCGGCGTCTGGCGCGCAGGGTGGAACGAGCGGGAGC
GGCGCTGCCGCCAGCGGCGGTTCTGGCAGCGCCACCGGGACCACCAGCGCGGCCGCGACGGTGGAAATCA
ACAGTTCGGATGACCGTAGCTGGAAGCAGACCCAGCTTAATGTGGCGGCGTTGCTGGTGGAGCGCCAGCC
GGAAGCGCCGGTAGGCTATCGCCTGCGCCGCAACGCGGTCTGGGCTGGGATCGCCACGCCGCCGACGACG
GCTCGCGGTAATAAAACCCAGCTGGCGCCGGTGTCGCCCGATCGGGTGGATGAATACCAGAGCGCGCTTG
GGCAGGCTGACCTGGCGTTGTGGAACAAGATTGAACAGAGCCTGACGCTGGCGCCGTACTGGTTTGACGG
CCACATGCTGTCGGCGACGGTGGCGACCCGGCTGGGGCACAGCGCCGTCGCCGGCGCCATCGCCGATGAA
TTGTCGGCGTTTCTCGCCCGGCTGCCGGAACTGCGCGAGCTGGCGTTCAGCGACGGTTCGCCGTTTCTGT
CGGCTAAATGCGCCCAGTGGCTGCAATCCTCCCAGCCGGCGCGCGGCGGCGGTGGTCAACGGCAGGACGA
TTTGGCGGCCGAGGCGGCGGCCTGCTGCGCCGAGCAAGGGTTAGGCGCGGCGCTGTCGCTGCTGGATGAG
CGTATTCGGCGGTTGAAAGAGCCGCGCGAGCGTTTTTGCGCCGAACTGGTGCTGGCGGATTTGCTGGCGG
AAGAAGGCATGAAAGCGCTGGCGGCACAACATTATCAGCACCTGTGGCAGGAAAGCGAGCGACTGGGCCT
GATGCAGTGGGAACCGGGAATGGTCAGCCGACTGGAGCGGCTGGGCGCGTCCCGCAGGAAATAA