SecReT6
Protein ID: 307130232
SecReT6 ID409
T6SS typei1
Gene symbol-
Locus tagDda3937_00803
StrainDickeya dadantii 3937
Repliconchromosome [GenBank: NC_014500] [Browse all T6SS(s) in this replicon]
Location [Strand]1593131..1594564 [+]
Producthypothetical protein
NoteTssA
UniProt IDE0SGP2
KEGG IDddd:Dda3937_00803
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 1.50E-37, Aligned region: 324..472
ImpA-rel_N [PF06812], Evalue: 2.90E-19, Aligned region: 39..98
Protein Sequence: 477 a.a.     [Download]
>gi|307130232|ref|YP_003882248.1| unnamed protein product [Dickeya dadantii 3937]
MQDAQQALKVGRDPRMLPEYEALRAEINKLSHASRPEVDWMRVHDMATAIFEKQGVDLQTAIYFTLARSR
LAGLNGFTEGCEFLANLIVTQWENFWPPVHQERARIEILDWFIARISEVIRQYAISHEHKRLVYRCERAL
QLMSEKLHNSGLSRIPRVENLLHFIEGYTHLFDETEIVIVSDDQTLKKQQDMQIPPMVFFQSDMEPGGMA
STAAAAQPALPSGSILVGREKGQMKPTVLKIEAHRKQKPAWFWFVCGVLTCALPVAAVSGWQYWQDQKTE
ALALLQQPAYALPAAPDHNDIRRVRIVLGEQKLQGMEGELINRYQAQLEQVKNASPFYLFQYGEGLKGVM
QQLYPDSLAVKEMDRQWQKALDRQQGDKPPRVSGYEQARAGVGDTLQQLLDLEKQRRTVTISYLKSQLYD
IQKDLASDVPFGLRLRTLEARKAARQSLTPAELRAMEDELRAFTIRLYRLQQGDSGS
 
Nucleotide Sequence: 1434 bp     [Download]
>gi|307128764|ref|NC_014500.1|:1593131-1594564 Dickeya dadantii 3937 chromosome, complete genome
ATGCAAGATGCACAACAGGCCCTGAAAGTGGGCCGCGATCCACGGATGCTGCCCGAGTACGAGGCGTTAC
GCGCGGAAATCAACAAGCTGAGCCATGCATCCCGCCCGGAAGTGGACTGGATGCGGGTGCACGATATGGC
GACCGCTATCTTCGAGAAGCAGGGCGTCGATCTGCAAACCGCCATCTATTTCACCCTGGCGCGCTCGCGT
CTGGCCGGGTTGAACGGCTTTACCGAGGGCTGTGAATTTCTCGCCAACCTGATCGTCACCCAGTGGGAAA
ACTTCTGGCCGCCGGTGCATCAGGAGCGGGCGCGTATCGAAATTCTGGATTGGTTTATCGCCCGCATCAG
CGAGGTGATTCGCCAGTACGCCATCAGCCACGAACACAAGCGGCTGGTTTACCGCTGCGAACGCGCGCTG
CAACTGATGAGCGAAAAGCTGCACAATTCCGGCCTGAGCCGCATTCCCCGGGTGGAAAACCTGTTGCACT
TTATCGAGGGTTACACCCATCTGTTTGACGAAACCGAGATTGTGATTGTCTCTGACGATCAAACACTGAA
AAAACAGCAGGATATGCAGATTCCGCCGATGGTGTTCTTCCAGTCCGACATGGAACCGGGCGGGATGGCG
TCCACGGCGGCGGCAGCCCAGCCGGCGCTGCCGTCGGGCAGTATTCTGGTCGGGCGGGAGAAAGGGCAGA
TGAAACCGACGGTATTGAAGATTGAGGCGCACCGCAAGCAGAAACCGGCCTGGTTCTGGTTTGTCTGCGG
CGTGCTGACCTGTGCGCTGCCGGTGGCGGCGGTGAGCGGCTGGCAGTACTGGCAGGATCAGAAAACCGAG
GCGCTGGCGCTGTTGCAGCAGCCGGCCTACGCGCTGCCGGCCGCGCCGGATCACAATGACATCCGCCGGG
TGCGCATCGTGCTGGGCGAACAGAAGCTGCAAGGCATGGAAGGCGAGCTGATCAACCGTTATCAGGCGCA
ACTGGAGCAGGTGAAGAACGCCTCGCCGTTCTATCTGTTCCAGTATGGCGAAGGGCTGAAAGGCGTGATG
CAGCAACTGTATCCGGACTCGCTGGCGGTCAAAGAGATGGACCGTCAGTGGCAGAAAGCCCTCGACCGCC
AGCAGGGCGACAAGCCGCCGCGCGTCAGCGGCTACGAACAGGCGCGCGCCGGGGTGGGCGACACCCTGCA
ACAGCTGCTGGATCTGGAAAAACAGCGTCGCACGGTGACCATTTCGTACCTGAAGTCCCAACTCTACGAT
ATTCAGAAAGATTTGGCTTCCGATGTGCCGTTTGGCCTCCGTTTGCGCACGCTGGAGGCGCGCAAGGCCG
CCCGCCAGTCGCTGACCCCGGCGGAGCTGCGCGCCATGGAAGATGAACTGCGTGCGTTCACTATCCGGCT
GTACCGGTTGCAGCAAGGCGATAGCGGCAGTTAA