SecReT6
Protein ID: 307545497
SecReT6 ID410
T6SS typei1
Gene symbolvgrG
Locus tagHELO_2907
StrainHalomonas elongata DSM 2581
Repliconchromosome [GenBank: NC_014532] [Browse all T6SS(s) in this replicon]
Location [Strand]2227498..2229576 [-]
Productrhs element Vgr protein
NoteTssI
UniProt IDE1V3W2
KEGG IDhel:HELO_2907
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.50E-68, Aligned region: 29..333
Phage_GPD [PF05954], Evalue: 2.50E-68, Aligned region: 539..571
Phage_base_V [PF04717], Evalue: 1.50E-22, Aligned region: 374..467
DUF2345 [PF10106], Evalue: 0.0018, Aligned region: 501..512
DUF2345 [PF10106], Evalue: 0.0018, Aligned region: 576..619
Protein Sequence: 692 a.a.     [Download]
>gi|307545497|ref|YP_003897976.1| vgrG gene product [Halomonas elongata DSM 2581]
MADRSGLQFTLSLTGAGEADLAVVDFTHEEALSSPFHLHVRFASRAVDLSPEALLDRPASLTVWQDGVAQ
RRVHGIVAEFGRGDRGHRRSHYEVVIRPSLWRLSLRQNSRIFQRVSPLTILNTLCEERGLTDVAFAVTRE
PAEREYCVQYRETDLAFVERLAAEEGLFYFHEFEDGDLGAHRLVFADDPQVLTGLGERPYHHRAGGTAPQ
RHLRRLTQTARVRPARAQLKDYSFKRPAYAQLHERQGDGLEQHSQRGDYEHYDYPGRYKADASGQAFTRH
RLEHLRHDALTLAGESDLPELAPGTRFTLADHDVSELNRGWQVVKVVHAGEQPQALGEDAAQADGMTRYH
NTLTLTPDDTAWRPAPEPKPRVDGPQVAFVVGPEGEEIHCDAHGRVRCQFPWDRYAEPNETASAWLRVSQ
GWAGGGYGMMAIPRIGHEVIVSFLEGDPDQPIITGRTYHAVNTPPYELPAHKTRTVLRTQTHQGEGFNEL
RFEDQHDQEQIWVHAQKDLELLTENDRTEEIRRDSHLAVKRDRVSELDRDDHLTVHGERRTQIDGDDHLN
VGQTRHEKIGRAQLVEAGSEVHHKAGMKVVVEAGAEITLKAGGSFLKLDPSGVTINGPSVKINSGGSPGS
GTGQSAQAPILPGEAGEETHEAIQPITHEALLSASAEEASVVQLCQKQTDGSCPLADCPCRS
 
Nucleotide Sequence: 2079 bp     [Download]
>gi|307543589|ref|NC_014532.1|:c2229576-2227498 Halomonas elongata DSM 2581 chromosome, complete genome
ATGGCCGATCGCAGCGGACTGCAGTTCACCCTGAGCCTGACCGGCGCCGGTGAGGCCGACCTGGCGGTGG
TCGACTTCACCCATGAAGAGGCGCTGTCGTCGCCGTTTCATCTTCACGTGCGCTTTGCCAGCCGCGCCGT
CGACCTCTCGCCGGAAGCGCTGCTCGACCGCCCGGCGAGCCTCACCGTGTGGCAGGACGGCGTGGCCCAG
CGACGGGTTCACGGCATCGTCGCCGAATTCGGTCGCGGCGACCGCGGCCATCGGCGCAGCCACTACGAGG
TCGTGATCCGCCCCTCGCTGTGGCGGCTCTCGTTGCGCCAGAACTCGCGGATCTTCCAGCGCGTCTCGCC
GCTGACCATCCTCAACACCCTGTGCGAGGAACGCGGCCTGACCGACGTGGCCTTCGCGGTGACCCGCGAG
CCCGCCGAGCGCGAGTACTGCGTGCAGTACCGCGAGACCGACCTGGCCTTCGTCGAGCGCCTGGCCGCCG
AGGAAGGGTTGTTCTACTTCCATGAGTTCGAGGATGGCGACCTCGGCGCCCATCGGCTGGTGTTCGCCGA
CGATCCCCAGGTGCTCACCGGGCTCGGCGAGCGCCCCTACCACCATCGCGCCGGCGGCACCGCGCCGCAG
CGTCACCTGCGCCGGCTGACCCAGACTGCCCGGGTGCGCCCGGCCCGGGCCCAGCTCAAGGACTACAGCT
TCAAGCGCCCGGCCTACGCGCAACTGCACGAGCGCCAGGGCGACGGGCTGGAGCAGCACAGCCAGCGGGG
CGACTACGAACACTACGACTACCCGGGCCGCTACAAGGCCGACGCCTCGGGCCAGGCCTTCACCCGCCAC
CGGCTGGAGCACCTGCGCCACGACGCCCTGACCCTGGCCGGCGAGAGCGACCTGCCCGAGCTGGCCCCGG
GCACGCGCTTCACCCTGGCCGACCACGACGTCAGCGAGCTCAACCGCGGCTGGCAGGTCGTCAAGGTGGT
CCACGCGGGCGAACAGCCCCAGGCACTGGGCGAGGACGCCGCCCAGGCCGACGGCATGACCCGTTACCAC
AACACCCTGACGCTGACCCCGGACGACACCGCCTGGCGGCCCGCGCCCGAGCCCAAGCCGCGGGTCGACG
GCCCTCAGGTGGCCTTCGTGGTGGGCCCCGAGGGCGAGGAGATTCACTGCGACGCTCACGGCCGGGTGCG
CTGCCAGTTCCCCTGGGACCGCTATGCCGAGCCCAATGAAACCGCCAGTGCCTGGCTGCGCGTCAGCCAG
GGCTGGGCCGGCGGCGGCTACGGCATGATGGCGATTCCGCGCATCGGCCACGAGGTGATCGTCTCCTTCC
TGGAAGGCGACCCCGACCAGCCGATCATTACCGGACGCACCTACCACGCGGTGAATACGCCGCCCTACGA
GCTGCCGGCGCACAAGACGCGCACCGTGCTGCGTACCCAGACCCACCAGGGCGAGGGCTTCAACGAACTG
CGCTTCGAGGACCAGCACGACCAGGAACAGATCTGGGTGCACGCGCAGAAGGACCTGGAGCTGCTCACCG
AGAACGACCGCACCGAGGAAATCCGCCGCGACAGCCATCTGGCCGTCAAGCGCGACCGGGTGAGCGAACT
CGACCGTGACGACCACCTCACCGTGCATGGCGAGCGGCGTACCCAGATTGATGGCGACGACCACCTCAAC
GTGGGCCAGACCCGTCACGAGAAGATCGGTCGCGCCCAACTCGTCGAGGCCGGCAGCGAAGTGCACCACA
AGGCCGGCATGAAGGTGGTGGTCGAAGCCGGCGCCGAGATCACCCTCAAGGCCGGTGGCAGCTTCCTGAA
GCTCGACCCCAGCGGCGTGACCATCAACGGGCCGAGCGTGAAGATCAACTCCGGCGGCAGCCCCGGCTCG
GGCACCGGGCAGAGTGCCCAGGCGCCGATATTGCCGGGGGAAGCGGGTGAGGAAACGCATGAGGCGATCC
AGCCCATCACTCACGAGGCCTTGCTGTCGGCATCGGCTGAGGAGGCTAGTGTCGTGCAGCTCTGCCAGAA
ACAGACCGATGGCAGTTGCCCGCTGGCTGACTGCCCGTGCCGTAGCTAG

Protein ID: 307545518
SecReT6 ID410
T6SS typei1
Gene symbolvgrG
Locus tagHELO_2928
StrainHalomonas elongata DSM 2581
Repliconchromosome [GenBank: NC_014532] [Browse all T6SS(s) in this replicon]
Location [Strand]2256752..2258833 [-]
Productrhs element Vgr protein
NoteTssI
UniProt IDE1V3Y3
KEGG IDhel:HELO_2928
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.10E-69, Aligned region: 29..333
Phage_base_V [PF04717], Evalue: 1.90E-22, Aligned region: 374..467
DUF2345 [PF10106], Evalue: 4.90E-07, Aligned region: 504..620
DUF2917 [PF11142], Evalue: 0.0015, Aligned region: 562..603
Protein Sequence: 693 a.a.     [Download]
>gi|307545518|ref|YP_003897997.1| vgrG gene product [Halomonas elongata DSM 2581]
MTQANGLQFTLSLTGAGEADLAVVDFTHEEALSSPFHLHVRFASRAVDLSPEALLDRPASLTVWQDGVAQ
RRVHGIVAEFGRGDRGHRRSHYEVVIRPSLWRLSLRQNSRIFQRVSPLTILNTLCEERGLTDVAFAVTRE
PAEREYCVQYRETDLAFVERLAAEEGLFYFHEFEDGDLGAHRLVFADDPQVLTGLGERPYHHRAGGTAPQ
RHLRRLTQTARVRPARAQLKDYSFKRPAYAQLHERQGDGLEQYSQRGDYEHYDYPGRYKADASGQAFTRH
RLEHLRHDALTLAGESDLPELAPGTRFTLADHDVSELNRGWQVVKVVHEGEQPQALGEDAAQDDGMTRYH
NTLTLIPDDTAWRPAPEPKPRVDGPQVAFVVGPEGEEIHCDAHGRVRCQFPWDRYAEPNETASAWLRVSQ
GWAGGGYGMMAIPRIGHEVIVSFLEGDPDQPIITGRTYHAVNTPPYELPAHKTRTVLRTQTHQGEGFNEL
RFEDQHDQEQIWVHAQKDLELLTENDRTEEIRRDSHLAVKRDRVSELDRDDHLTVHGERREKSDGAQHLT
IDGSLHLSAGQAWLTESGRELHIKAGQKVVLEAGSELTLKAGGSFLKIDGGGVTVNGPGVKVNAGGSPGS
GTGQGAQAPLLPGHAEPEVHEAIAPTALPKLRDYQLAEAALMPLCGKISDTQCSREDCPCLGG
 
Nucleotide Sequence: 2082 bp     [Download]
>gi|307543589|ref|NC_014532.1|:c2258833-2256752 Halomonas elongata DSM 2581 chromosome, complete genome
ATGACCCAGGCTAACGGACTGCAGTTCACCCTGAGCCTGACCGGCGCCGGTGAGGCCGACCTGGCGGTGG
TCGACTTCACCCATGAAGAGGCGCTGTCGTCGCCGTTTCATCTTCATGTGCGCTTTGCCAGCCGCGCCGT
CGACCTCTCGCCGGAAGCGCTGCTCGACCGCCCGGCGAGCCTCACCGTGTGGCAGGACGGCGTGGCCCAG
CGGCGGGTTCACGGCATCGTCGCCGAGTTCGGTCGCGGCGACCGCGGCCATCGGCGCAGCCACTACGAGG
TCGTGATCCGCCCCTCGCTGTGGCGGCTCTCGTTGCGCCAGAACTCGCGGATCTTCCAGCGCGTCTCGCC
GCTGACCATCCTCAACACCCTGTGTGAGGAACGCGGCCTGACCGACGTGGCCTTCGCGGTGACCCGCGAG
CCCGCCGAGCGCGAGTACTGCGTGCAGTACCGCGAGACCGACCTGGCGTTCGTCGAGCGCCTGGCCGCCG
AGGAAGGGCTGTTCTACTTCCATGAGTTCGAGGATGGCGACCTCGGTGCTCATCGGCTGGTGTTCGCCGA
CGATCCCCAGGTGCTCACCGGGCTCGGCGAGCGTCCCTACCACCATCGCGCCGGCGGCACCGCGCCGCAG
CGTCACCTGCGCCGGCTGACCCAGACCGCTCGGGTGCGCCCGGCCCGGGCCCAGCTCAAGGACTACAGCT
TCAAGCGCCCGGCCTACGCGCAACTGCACGAGCGCCAGGGCGACGGGCTGGAGCAGTACAGCCAGCGGGG
CGACTACGAACACTACGACTACCCGGGCCGCTACAAGGCCGACGCCTCGGGCCAGGCCTTTACCCGCCAC
CGGCTGGAGCACCTGCGTCACGACGCCCTGACCCTGGCCGGCGAGAGCGACCTGCCCGAGCTGGCCCCGG
GCACGCGCTTCACCCTGGCCGACCACGACGTCAGCGAGCTCAACCGCGGCTGGCAGGTCGTCAAGGTGGT
CCACGAGGGCGAACAGCCCCAGGCGCTGGGCGAGGACGCCGCCCAGGACGACGGCATGACCCGCTACCAC
AACACCCTGACGCTGATCCCGGACGACACCGCCTGGCGGCCCGCGCCCGAGCCCAAGCCGCGGGTCGACG
GCCCCCAGGTGGCCTTCGTGGTGGGGCCCGAGGGCGAGGAGATTCACTGCGACGCTCACGGCCGGGTGCG
CTGCCAGTTCCCCTGGGATCGCTATGCCGAGCCCAATGAAACCGCCAGTGCCTGGCTGCGCGTCAGCCAG
GGCTGGGCCGGCGGCGGCTACGGCATGATGGCGATTCCGCGCATCGGCCACGAGGTGATCGTCTCTTTCC
TGGAAGGCGACCCCGACCAGCCGATCATTACCGGGCGCACCTACCACGCGGTGAATACGCCGCCCTACGA
GCTGCCAGCGCACAAGACGCGCACCGTGCTGCGCACCCAGACCCACCAGGGCGAGGGCTTCAACGAACTG
CGCTTCGAGGACCAGCACGACCAGGAACAGATCTGGGTGCACGCCCAGAAGGACCTGGAGCTGCTCACCG
AGAACGACCGCACCGAGGAAATCCGCCGCGACAGCCACCTGGCCGTCAAGCGCGACCGGGTGAGCGAGCT
CGACCGTGACGACCACCTCACCGTGCATGGCGAGCGACGCGAGAAAAGCGATGGCGCCCAGCACCTGACC
ATCGATGGCAGCCTGCATCTGAGCGCAGGCCAGGCCTGGCTCACCGAAAGCGGCCGCGAACTGCACATCA
AGGCCGGCCAGAAGGTGGTGCTGGAGGCAGGCAGCGAGCTGACCCTCAAGGCCGGCGGCAGTTTTCTCAA
GATCGATGGTGGCGGTGTCACCGTCAACGGCCCCGGCGTGAAGGTAAATGCCGGCGGCAGTCCCGGCAGC
GGCACGGGGCAGGGCGCCCAGGCACCGCTGTTGCCGGGGCATGCCGAACCGGAAGTGCACGAGGCGATTG
CCCCCACTGCGCTACCTAAACTGCGTGACTACCAGCTCGCGGAAGCGGCGTTGATGCCCCTGTGCGGCAA
GATCAGCGACACCCAGTGCAGTCGAGAGGATTGTCCATGTCTGGGTGGCTAG